mirror of
https://github.com/opencloud-eu/opencloud.git
synced 2026-02-11 14:51:33 -05:00
Compare commits
119 Commits
bump-versi
...
remove-wor
| Author | SHA1 | Date | |
|---|---|---|---|
|
|
31fa450980 | ||
|
|
e734f735ad | ||
|
|
9e78188f9a | ||
|
|
873ad0f5b4 | ||
|
|
39a499fc01 | ||
|
|
77b103bec0 | ||
|
|
fe5309a4a2 | ||
|
|
78bacea4f6 | ||
|
|
945c04d448 | ||
|
|
f208268bad | ||
|
|
186072998a | ||
|
|
7276ce1340 | ||
|
|
f23fe92fcd | ||
|
|
ad377042dc | ||
|
|
6af2ecfdde | ||
|
|
f6a6b9689e | ||
|
|
7f36d68cfc | ||
|
|
90d2f17315 | ||
|
|
ea8507cc9f | ||
|
|
a5ebc0adec | ||
|
|
a95d75813c | ||
|
|
b1268f49c3 | ||
|
|
2babc5a48b | ||
|
|
be13bac7f7 | ||
|
|
f2ee327295 | ||
|
|
94f5162633 | ||
|
|
7e9a7d8099 | ||
|
|
a4164da9ed | ||
|
|
6386dd4e18 | ||
|
|
32a28c47d9 | ||
|
|
7eae811b18 | ||
|
|
9b1a79f7d7 | ||
|
|
3ca9a59aaa | ||
|
|
58932bbe99 | ||
|
|
cf2318d607 | ||
|
|
8a3aeb5b98 | ||
|
|
d07608758b | ||
|
|
56753d5c46 | ||
|
|
58671abc6a | ||
|
|
5410caea4d | ||
|
|
d2d33e4d48 | ||
|
|
7c040b0b9d | ||
|
|
bd1fc8a70b | ||
|
|
882894d0e2 | ||
|
|
8290d8bf9d | ||
|
|
a86c6ea708 | ||
|
|
d7391a5bd5 | ||
|
|
45c3234332 | ||
|
|
d06cca6fab | ||
|
|
a2b6ebf750 | ||
|
|
077c3c0268 | ||
|
|
382c4228e2 | ||
|
|
e849dc345c | ||
|
|
0179d0e1ae | ||
|
|
87def992c8 | ||
|
|
c31d42bc7e | ||
|
|
862e306260 | ||
|
|
56636cc9c4 | ||
|
|
a484237fcc | ||
|
|
a98c63846c | ||
|
|
6fc05f592b | ||
|
|
7c5fb08262 | ||
|
|
2174942a93 | ||
|
|
a325586c85 | ||
|
|
9ec6e3eebf | ||
|
|
b5d87db137 | ||
|
|
ec3555e348 | ||
|
|
b1d08cb542 | ||
|
|
8278c079e4 | ||
|
|
b0f3ab6252 | ||
|
|
56c387cfa0 | ||
|
|
95ae1ea32a | ||
|
|
43677a0cd2 | ||
|
|
f25e191a46 | ||
|
|
4372244eeb | ||
|
|
8a8523c922 | ||
|
|
dea654edbc | ||
|
|
c2c0e61d5e | ||
|
|
c45b725182 | ||
|
|
e5e2626a11 | ||
|
|
6fcb47ce11 | ||
|
|
9949d4a57a | ||
|
|
d02c854971 | ||
|
|
91c2624c04 | ||
|
|
0636d906ac | ||
|
|
2609d0e589 | ||
|
|
4bbd46d238 | ||
|
|
90b67351cf | ||
|
|
3bcef42910 | ||
|
|
09818a9d7e | ||
|
|
3625eebe64 | ||
|
|
054c87b3fd | ||
|
|
b4a607965f | ||
|
|
37d6cd653d | ||
|
|
ff91a5014f | ||
|
|
1eb7683176 | ||
|
|
c73a552d52 | ||
|
|
822de1ad8e | ||
|
|
874601ab8f | ||
|
|
965a626a01 | ||
|
|
86354e6917 | ||
|
|
537b7056eb | ||
|
|
495cb289e7 | ||
|
|
dd30b5b53b | ||
|
|
034b5d2c4e | ||
|
|
ec43da4ed1 | ||
|
|
cb243448cc | ||
|
|
9feb51dd0d | ||
|
|
8c5af66b1f | ||
|
|
f0e62323cb | ||
|
|
2ffbb1f201 | ||
|
|
1607135488 | ||
|
|
85327e659c | ||
|
|
97ff296340 | ||
|
|
18e81d441a | ||
|
|
806fb8f1c4 | ||
|
|
c3e0fcc967 | ||
|
|
26e172cfad | ||
|
|
90e2221164 |
28
.github/workflows/labels.yml
vendored
Normal file
28
.github/workflows/labels.yml
vendored
Normal file
@@ -0,0 +1,28 @@
|
||||
name: Require Pull Request Labels
|
||||
on:
|
||||
pull_request:
|
||||
types: [opened, labeled, unlabeled, synchronize]
|
||||
jobs:
|
||||
label:
|
||||
runs-on: ubuntu-latest
|
||||
permissions:
|
||||
issues: write
|
||||
pull-requests: write
|
||||
steps:
|
||||
- uses: mheap/github-action-required-labels@v5
|
||||
with:
|
||||
mode: minimum
|
||||
count: 1
|
||||
labels: |
|
||||
Type:Bug
|
||||
Type:Enhancement
|
||||
Type:Feature
|
||||
Type:Breaking-Change
|
||||
Type:Test
|
||||
Type:Documentation
|
||||
Type:Maintenance
|
||||
Type:Security
|
||||
Type:Dependencies
|
||||
Type:DevOps
|
||||
dependencies
|
||||
add_comment: true
|
||||
15
.make/go.mk
15
.make/go.mk
@@ -18,21 +18,20 @@ SOURCES ?= $(shell find . -name "*.go" -type f -not -path "./node_modules/*")
|
||||
TAGS ?=
|
||||
|
||||
ifndef OUTPUT
|
||||
ifneq ($(DRONE_TAG),)
|
||||
OUTPUT ?= $(subst v,,$(DRONE_TAG))
|
||||
ifneq ($(CI_COMMIT_TAG),)
|
||||
OUTPUT ?= $(subst v,,$(CI_COMMIT_TAG))
|
||||
else
|
||||
OUTPUT ?= testing
|
||||
endif
|
||||
endif
|
||||
|
||||
ifndef VERSION
|
||||
ifneq ($(DRONE_TAG),)
|
||||
VERSION ?= $(subst v,,$(DRONE_TAG))
|
||||
else
|
||||
STRING ?= $(shell git rev-parse --short HEAD)
|
||||
endif
|
||||
ifeq ($(VERSION), daily)
|
||||
STRING ?= $(shell git rev-parse --short HEAD)
|
||||
else ifeq ($(VERSION),)
|
||||
STRING ?= $(shell git rev-parse --short HEAD)
|
||||
endif
|
||||
|
||||
|
||||
ifndef DATE
|
||||
DATE := $(shell date -u '+%Y%m%d')
|
||||
endif
|
||||
|
||||
@@ -1,3 +1,3 @@
|
||||
# The test runner source for UI tests
|
||||
WEB_COMMITID=4f68c1e1dbcc88839e42c17c57f31dec243d7bd0
|
||||
WEB_COMMITID=25629bf0d846051ec0ed6f56ddbeb1a4de6f9ba0
|
||||
WEB_BRANCH=main
|
||||
|
||||
358
.woodpecker.star
358
.woodpecker.star
@@ -23,7 +23,6 @@ OC_CI_ALPINE = "owncloudci/alpine:latest"
|
||||
OC_CI_BAZEL_BUILDIFIER = "owncloudci/bazel-buildifier:latest"
|
||||
OC_CI_CLAMAVD = "owncloudci/clamavd"
|
||||
OC_CI_DRONE_ANSIBLE = "owncloudci/drone-ansible:latest"
|
||||
OC_CI_DRONE_SKIP_PIPELINE = "owncloudci/drone-skip-pipeline"
|
||||
OC_CI_GOLANG = "docker.io/golang:1.24"
|
||||
OC_CI_NODEJS = "owncloudci/nodejs:%s"
|
||||
OC_CI_PHP = "owncloudci/php:%s"
|
||||
@@ -32,18 +31,12 @@ OC_CS3_API_VALIDATOR = "opencloudeu/cs3api-validator:latest"
|
||||
OC_LITMUS = "owncloudci/litmus:latest"
|
||||
OC_UBUNTU = "owncloud/ubuntu:20.04"
|
||||
ONLYOFFICE_DOCUMENT_SERVER = "onlyoffice/documentserver:7.5.1"
|
||||
PLUGINS_CODACY = "plugins/codacy:1"
|
||||
PLUGINS_DOCKER_BUILDX = "woodpeckerci/plugin-docker-buildx:latest"
|
||||
PLUGINS_GH_PAGES = "plugins/gh-pages:1"
|
||||
PLUGINS_GITHUB_RELEASE = "woodpeckerci/plugin-release"
|
||||
PLUGINS_GIT_ACTION = "plugins/git-action:1"
|
||||
PLUGINS_GIT_PUSH = "appleboy/drone-git-push"
|
||||
PLUGINS_MANIFEST = "plugins/manifest:1"
|
||||
PLUGINS_S3 = "plugins/s3:1"
|
||||
PLUGINS_S3_CACHE = "plugins/s3-cache:1"
|
||||
PLUGINS_SLACK = "plugins/slack:1"
|
||||
REDIS = "redis:6-alpine"
|
||||
SONARSOURCE_SONAR_SCANNER_CLI = "sonarsource/sonar-scanner-cli:11.0"
|
||||
READY_RELEASE_GO = "woodpeckerci/plugin-ready-release-go:latest"
|
||||
|
||||
DEFAULT_PHP_VERSION = "8.2"
|
||||
@@ -55,11 +48,8 @@ dirs = {
|
||||
"zip": "/woodpecker/src/github.com/opencloud-eu/opencloud/zip",
|
||||
"webZip": "/woodpecker/src/github.com/opencloud-eu/opencloud/zip/web.tar.gz",
|
||||
"webPnpmZip": "/woodpecker/src/github.com/opencloud-eu/opencloud/zip/web-pnpm.tar.gz",
|
||||
"baseGo": "/go/src/github.com/opencloud-eu/opencloud",
|
||||
"gobinTar": "go-bin.tar.gz",
|
||||
"gobinTarPath": "/go/src/github.com/opencloud-eu/opencloud/go-bin.tar.gz",
|
||||
"opencloudConfig": "tests/config/woodpecker/opencloud-config.json",
|
||||
"ocis": "/woodpecker/src/github.com/opencloud-eu/opencloud/srv/app/tmp/ocis",
|
||||
"opencloudRevaDataRoot": "/woodpecker/src/github.com/opencloud-eu/opencloud/srv/app/tmp/ocis/owncloud/data",
|
||||
"multiServiceOcBaseDataPath": "/woodpecker/src/github.com/opencloud-eu/opencloud/multiServiceData",
|
||||
"ocWrapper": "/woodpecker/src/github.com/opencloud-eu/opencloud/tests/ocwrapper",
|
||||
@@ -78,6 +68,19 @@ FED_OC_SERVER_NAME = "federation-opencloud-server"
|
||||
OC_FED_URL = "https://%s:10200" % FED_OC_SERVER_NAME
|
||||
OC_FED_DOMAIN = "%s:10200" % FED_OC_SERVER_NAME
|
||||
|
||||
event = {
|
||||
"base": {
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
"pull_request": {
|
||||
"event": "pull_request",
|
||||
},
|
||||
"tag": {
|
||||
"event": "tag",
|
||||
},
|
||||
}
|
||||
|
||||
# configuration
|
||||
config = {
|
||||
"cs3ApiTests": {
|
||||
@@ -345,14 +348,6 @@ config = {
|
||||
|
||||
GRAPH_AVAILABLE_ROLES = "b1e2218d-eef8-4d4c-b82d-0f1a1b48f3b5,a8d5fe5e-96e3-418d-825b-534dbdf22b99,fb6c3e19-e378-47e5-b277-9732f9de6e21,58c63c02-1d89-4572-916a-870abc5a1b7d,2d00ce52-1fc2-4dbc-8b95-a73b73395f5a,1c996275-f1c9-4e71-abdf-a42f6495e960,312c0871-5ef7-4b3a-85b6-0e4074c64049,aa97fe03-7980-45ac-9e50-b325749fd7e6,63e64e19-8d43-42ec-a738-2b6af2610efa"
|
||||
|
||||
# workspace for pipeline to cache Go dependencies between steps of a pipeline
|
||||
# to be used in combination with stepVolumeGo
|
||||
workspace = \
|
||||
{
|
||||
"base": "/go",
|
||||
"path": "src/github.com/opencloud-eu/opencloud/",
|
||||
}
|
||||
|
||||
# minio mc environment variables
|
||||
MINIO_MC_ENV = {
|
||||
"CACHE_BUCKET": {
|
||||
@@ -416,8 +411,6 @@ def main(ctx):
|
||||
none
|
||||
"""
|
||||
|
||||
pipelines = []
|
||||
|
||||
build_release_helpers = \
|
||||
readyReleaseGo() + \
|
||||
docs()
|
||||
@@ -431,8 +424,8 @@ def main(ctx):
|
||||
|
||||
test_pipelines = \
|
||||
codestyle(ctx) + \
|
||||
checkGherkinLint(ctx) + \
|
||||
checkTestSuitesInExpectedFailures(ctx) + \
|
||||
checkGherkinLint() + \
|
||||
checkTestSuitesInExpectedFailures() + \
|
||||
buildWebCache(ctx) + \
|
||||
getGoBinForTesting(ctx) + \
|
||||
buildOpencloudBinaryForTesting(ctx) + \
|
||||
@@ -474,7 +467,7 @@ def main(ctx):
|
||||
),
|
||||
)
|
||||
|
||||
pipelineSanityChecks(ctx, pipelines)
|
||||
pipelineSanityChecks(pipelines)
|
||||
return pipelines
|
||||
|
||||
def cachePipeline(name, steps):
|
||||
@@ -487,9 +480,7 @@ def cachePipeline(name, steps):
|
||||
"event": ["push", "manual"],
|
||||
"branch": ["main", "stable-*"],
|
||||
},
|
||||
{
|
||||
"event": "pull_request",
|
||||
},
|
||||
event["pull_request"],
|
||||
],
|
||||
}
|
||||
|
||||
@@ -547,6 +538,7 @@ def getGoBinForTesting(ctx):
|
||||
"steps": checkGoBinCache() +
|
||||
cacheGoBin(),
|
||||
"when": [
|
||||
event["tag"],
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": ["main", "stable-*"],
|
||||
@@ -557,11 +549,7 @@ def getGoBinForTesting(ctx):
|
||||
"exclude": skipIfUnchanged(ctx, "unit-tests"),
|
||||
},
|
||||
},
|
||||
{
|
||||
"event": "tag",
|
||||
},
|
||||
],
|
||||
"workspace": workspace,
|
||||
}]
|
||||
|
||||
def checkGoBinCache():
|
||||
@@ -570,7 +558,7 @@ def checkGoBinCache():
|
||||
"image": MINIO_MC,
|
||||
"environment": MINIO_MC_ENV,
|
||||
"commands": [
|
||||
"bash -x %s/tests/config/woodpecker/check_go_bin_cache.sh %s %s" % (dirs["baseGo"], dirs["baseGo"], dirs["gobinTar"]),
|
||||
"bash -x %s/tests/config/woodpecker/check_go_bin_cache.sh %s %s" % (dirs["base"], dirs["base"], dirs["gobinTar"]),
|
||||
],
|
||||
}]
|
||||
|
||||
@@ -588,12 +576,13 @@ def cacheGoBin():
|
||||
},
|
||||
{
|
||||
"name": "archive-go-bin",
|
||||
"image": OC_UBUNTU,
|
||||
"image": OC_CI_GOLANG,
|
||||
"commands": [
|
||||
". ./.env",
|
||||
"if $BIN_CACHE_FOUND; then exit 0; fi",
|
||||
"tar -czvf %s /go/bin" % dirs["gobinTarPath"],
|
||||
"tar -czvf %s/%s /go/bin " % (dirs["base"], dirs["gobinTar"]),
|
||||
],
|
||||
"environment": CI_HTTP_PROXY_ENV,
|
||||
},
|
||||
{
|
||||
"name": "cache-go-bin",
|
||||
@@ -604,10 +593,10 @@ def cacheGoBin():
|
||||
"if $BIN_CACHE_FOUND; then exit 0; fi",
|
||||
# .bingo folder will change after 'bingo-get'
|
||||
# so get the stored hash of a .bingo folder
|
||||
"BINGO_HASH=$(cat %s/.bingo_hash)" % dirs["baseGo"],
|
||||
"BINGO_HASH=$(cat %s/.bingo_hash)" % dirs["base"],
|
||||
# cache using the minio client to the public bucket (long term bucket)
|
||||
"mc alias set s3 $MC_HOST $AWS_ACCESS_KEY_ID $AWS_SECRET_ACCESS_KEY",
|
||||
"mc cp -r %s s3/$CACHE_BUCKET/opencloud/go-bin/$BINGO_HASH" % (dirs["gobinTarPath"]),
|
||||
"mc cp -r %s/%s s3/$CACHE_BUCKET/opencloud/go-bin/$BINGO_HASH" % (dirs["base"], dirs["gobinTar"]),
|
||||
],
|
||||
},
|
||||
]
|
||||
@@ -619,22 +608,32 @@ def restoreGoBinCache():
|
||||
"image": MINIO_MC,
|
||||
"environment": MINIO_MC_ENV,
|
||||
"commands": [
|
||||
"BINGO_HASH=$(cat %s/.bingo/* | sha256sum | cut -d ' ' -f 1)" % dirs["baseGo"],
|
||||
"BINGO_HASH=$(cat %s/.bingo/* | sha256sum | cut -d ' ' -f 1)" % dirs["base"],
|
||||
"mc alias set s3 $MC_HOST $AWS_ACCESS_KEY_ID $AWS_SECRET_ACCESS_KEY",
|
||||
"mc cp -r -a s3/$CACHE_BUCKET/opencloud/go-bin/$BINGO_HASH/%s %s" % (dirs["gobinTar"], dirs["baseGo"]),
|
||||
"mc cp -r -a s3/$CACHE_BUCKET/opencloud/go-bin/$BINGO_HASH/%s %s" % (dirs["gobinTar"], dirs["base"]),
|
||||
],
|
||||
},
|
||||
{
|
||||
"name": "extract-go-bin-cache",
|
||||
"image": OC_UBUNTU,
|
||||
"image": OC_CI_GOLANG,
|
||||
"commands": [
|
||||
"tar -xvmf %s -C /" % dirs["gobinTarPath"],
|
||||
"tar -xvmf %s/%s -C %s" % (dirs["base"], dirs["gobinTar"], dirs["base"]),
|
||||
],
|
||||
},
|
||||
]
|
||||
|
||||
def testOpencloud(ctx):
|
||||
steps = restoreGoBinCache() + makeGoGenerate("") + [
|
||||
# environment = CI_HTTP_PROXY_ENV
|
||||
# environment["GOBIN"] = "/woodpecker/src/github.com/opencloud-eu/opencloud/go/bin"
|
||||
steps = restoreGoBinCache() + [
|
||||
{
|
||||
"name": "generate-go",
|
||||
"image": OC_CI_GOLANG,
|
||||
"commands": [
|
||||
"for i in $(seq 3); do %s go-generate && break || sleep 1; done" % make,
|
||||
],
|
||||
"environment": CI_HTTP_PROXY_ENV,
|
||||
},
|
||||
{
|
||||
"name": "golangci-lint",
|
||||
"image": OC_CI_GOLANG,
|
||||
@@ -680,10 +679,7 @@ def testOpencloud(ctx):
|
||||
"name": "linting_and_unitTests",
|
||||
"steps": steps,
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
event["base"],
|
||||
{
|
||||
"event": "pull_request",
|
||||
"path": {
|
||||
@@ -692,7 +688,6 @@ def testOpencloud(ctx):
|
||||
},
|
||||
],
|
||||
"depends_on": getPipelineNames(getGoBinForTesting(ctx)),
|
||||
"workspace": workspace,
|
||||
}
|
||||
|
||||
def scanOpencloud(ctx):
|
||||
@@ -711,10 +706,7 @@ def scanOpencloud(ctx):
|
||||
"name": "go-vulnerability-scanning",
|
||||
"steps": steps,
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
event["base"],
|
||||
{
|
||||
"event": "pull_request",
|
||||
"path": {
|
||||
@@ -722,8 +714,6 @@ def scanOpencloud(ctx):
|
||||
},
|
||||
},
|
||||
],
|
||||
"depends_on": getPipelineNames(getGoBinForTesting(ctx)),
|
||||
"workspace": workspace,
|
||||
}
|
||||
|
||||
def buildOpencloudBinaryForTesting(ctx):
|
||||
@@ -734,10 +724,7 @@ def buildOpencloudBinaryForTesting(ctx):
|
||||
build() +
|
||||
rebuildBuildArtifactCache(ctx, dirs["opencloudBinArtifact"], dirs["opencloudBinPath"]),
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
event["base"],
|
||||
{
|
||||
"event": "pull_request",
|
||||
"path": {
|
||||
@@ -745,7 +732,6 @@ def buildOpencloudBinaryForTesting(ctx):
|
||||
},
|
||||
},
|
||||
],
|
||||
"workspace": workspace,
|
||||
}]
|
||||
|
||||
def vendorbinCodestyle(phpVersion):
|
||||
@@ -772,7 +758,7 @@ def vendorbinCodesniffer(phpVersion):
|
||||
],
|
||||
}]
|
||||
|
||||
def checkTestSuitesInExpectedFailures(ctx):
|
||||
def checkTestSuitesInExpectedFailures():
|
||||
return [{
|
||||
"name": "check-suites-in-expected-failures",
|
||||
"steps": [
|
||||
@@ -784,14 +770,10 @@ def checkTestSuitesInExpectedFailures(ctx):
|
||||
],
|
||||
},
|
||||
],
|
||||
"when": [
|
||||
{
|
||||
"event": "pull_request",
|
||||
},
|
||||
],
|
||||
"when": [event["pull_request"]],
|
||||
}]
|
||||
|
||||
def checkGherkinLint(ctx):
|
||||
def checkGherkinLint():
|
||||
return [{
|
||||
"name": "check-gherkin-standard",
|
||||
"steps": [
|
||||
@@ -804,11 +786,7 @@ def checkGherkinLint(ctx):
|
||||
],
|
||||
},
|
||||
],
|
||||
"when": [
|
||||
{
|
||||
"event": "pull_request",
|
||||
},
|
||||
],
|
||||
"when": [event["pull_request"]],
|
||||
}]
|
||||
|
||||
def codestyle(ctx):
|
||||
@@ -869,10 +847,7 @@ def codestyle(ctx):
|
||||
],
|
||||
"depends_on": [],
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
event["base"],
|
||||
{
|
||||
"event": "pull_request",
|
||||
"path": {
|
||||
@@ -926,23 +901,20 @@ def localApiTestPipeline(ctx):
|
||||
"steps": restoreBuildArtifactCache(ctx, dirs["opencloudBinArtifact"], dirs["opencloudBinPath"]) +
|
||||
(tikaService() if params["tikaNeeded"] else []) +
|
||||
(waitForServices("online-offices", ["collabora:9980", "onlyoffice:443", "fakeoffice:8080"]) if params["collaborationServiceNeeded"] else []) +
|
||||
opencloudServer(storage, params["accounts_hash_difficulty"], extra_server_environment = params["extraServerEnvironment"], with_wrapper = True, tika_enabled = params["tikaNeeded"]) +
|
||||
(waitForClamavService() if params["antivirusNeeded"] else []) +
|
||||
(waitForEmailService() if params["emailNeeded"] else []) +
|
||||
opencloudServer(storage, params["accounts_hash_difficulty"], extra_server_environment = params["extraServerEnvironment"], with_wrapper = True, tika_enabled = params["tikaNeeded"]) +
|
||||
(opencloudServer(storage, params["accounts_hash_difficulty"], deploy_type = "federation", extra_server_environment = params["extraServerEnvironment"]) if params["federationServer"] else []) +
|
||||
((wopiCollaborationService("fakeoffice") + wopiCollaborationService("collabora") + wopiCollaborationService("onlyoffice")) if params["collaborationServiceNeeded"] else []) +
|
||||
(openCloudHealthCheck("wopi", ["wopi-collabora:9304", "wopi-onlyoffice:9304", "wopi-fakeoffice:9304"]) if params["collaborationServiceNeeded"] else []) +
|
||||
localApiTests(ctx, name, params["suites"], storage, params["extraEnvironment"], run_with_remote_php) +
|
||||
localApiTests(name, params["suites"], storage, params["extraEnvironment"], run_with_remote_php) +
|
||||
logRequests(),
|
||||
"services": (emailService() if params["emailNeeded"] else []) +
|
||||
(clamavService() if params["antivirusNeeded"] else []) +
|
||||
((fakeOffice() + collaboraService() + onlyofficeService()) if params["collaborationServiceNeeded"] else []),
|
||||
"depends_on": getPipelineNames(buildOpencloudBinaryForTesting(ctx)),
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
event["base"],
|
||||
{
|
||||
"event": "pull_request",
|
||||
"path": {
|
||||
@@ -954,9 +926,9 @@ def localApiTestPipeline(ctx):
|
||||
pipelines.append(pipeline)
|
||||
return pipelines
|
||||
|
||||
def localApiTests(ctx, name, suites, storage = "decomposed", extra_environment = {}, with_remote_php = False):
|
||||
def localApiTests(name, suites, storage = "decomposed", extra_environment = {}, with_remote_php = False):
|
||||
test_dir = "%s/tests/acceptance" % dirs["base"]
|
||||
expected_failures_file = "%s/expected-failures-localAPI-on-decomposed-storage.md" % (test_dir)
|
||||
expected_failures_file = "%s/expected-failures-localAPI-on-decomposed-storage.md" % test_dir
|
||||
|
||||
environment = {
|
||||
"TEST_SERVER_URL": OC_URL,
|
||||
@@ -990,7 +962,7 @@ def cs3ApiTests(ctx, storage, accounts_hash_difficulty = 4):
|
||||
return {
|
||||
"name": "cs3ApiTests-%s" % storage,
|
||||
"steps": restoreBuildArtifactCache(ctx, dirs["opencloudBinArtifact"], dirs["opencloudBinPath"]) +
|
||||
opencloudServer(storage, accounts_hash_difficulty, [], [], "cs3api_validator") +
|
||||
opencloudServer(storage, accounts_hash_difficulty, deploy_type = "cs3api_validator") +
|
||||
[
|
||||
{
|
||||
"name": "cs3ApiTests",
|
||||
@@ -1005,10 +977,7 @@ def cs3ApiTests(ctx, storage, accounts_hash_difficulty = 4):
|
||||
],
|
||||
"depends_on": getPipelineNames(buildOpencloudBinaryForTesting(ctx)),
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
event["base"],
|
||||
{
|
||||
"event": "pull_request",
|
||||
"path": {
|
||||
@@ -1036,7 +1005,6 @@ def wopiValidatorTests(ctx, storage, wopiServerType, accounts_hash_difficulty =
|
||||
]
|
||||
|
||||
validatorTests = []
|
||||
wopiServer = []
|
||||
extra_server_environment = {}
|
||||
|
||||
if wopiServerType == "cs3":
|
||||
@@ -1122,10 +1090,7 @@ def wopiValidatorTests(ctx, storage, wopiServerType, accounts_hash_difficulty =
|
||||
validatorTests,
|
||||
"depends_on": getPipelineNames(buildOpencloudBinaryForTesting(ctx)),
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
event["base"],
|
||||
{
|
||||
"event": "pull_request",
|
||||
"path": {
|
||||
@@ -1176,10 +1141,7 @@ def coreApiTests(ctx, part_number = 1, number_of_parts = 1, with_remote_php = Fa
|
||||
"services": redisForOCStorage(storage),
|
||||
"depends_on": getPipelineNames(buildOpencloudBinaryForTesting(ctx)),
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
event["base"],
|
||||
{
|
||||
"event": "pull_request",
|
||||
"path": {
|
||||
@@ -1204,7 +1166,7 @@ def apiTests(ctx):
|
||||
|
||||
for runPart in range(1, config["apiTests"]["numberOfParts"] + 1):
|
||||
for run_with_remote_php in defaults["withRemotePhp"]:
|
||||
if (not debugPartsEnabled or (debugPartsEnabled and runPart in debugParts)):
|
||||
if not debugPartsEnabled or (debugPartsEnabled and runPart in debugParts):
|
||||
pipelines.append(coreApiTests(ctx, runPart, config["apiTests"]["numberOfParts"], run_with_remote_php))
|
||||
|
||||
return pipelines
|
||||
@@ -1226,10 +1188,7 @@ def e2eTestPipeline(ctx):
|
||||
}
|
||||
|
||||
e2e_trigger = [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
event["base"],
|
||||
{
|
||||
"event": "pull_request",
|
||||
"path": {
|
||||
@@ -1244,10 +1203,10 @@ def e2eTestPipeline(ctx):
|
||||
|
||||
pipelines = []
|
||||
|
||||
if ("skip-e2e" in ctx.build.title.lower()):
|
||||
if "skip-e2e" in ctx.build.title.lower():
|
||||
return pipelines
|
||||
|
||||
if (ctx.build.event == "tag"):
|
||||
if ctx.build.event == "tag":
|
||||
return pipelines
|
||||
|
||||
storage = "posix"
|
||||
@@ -1335,10 +1294,7 @@ def multiServiceE2ePipeline(ctx):
|
||||
}
|
||||
|
||||
e2e_trigger = [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
event["base"],
|
||||
{
|
||||
"event": "pull_request",
|
||||
"path": {
|
||||
@@ -1347,11 +1303,11 @@ def multiServiceE2ePipeline(ctx):
|
||||
},
|
||||
]
|
||||
|
||||
if ("skip-e2e" in ctx.build.title.lower()):
|
||||
if "skip-e2e" in ctx.build.title.lower():
|
||||
return pipelines
|
||||
|
||||
# run this pipeline only for cron jobs and full-ci PRs
|
||||
if (not "full-ci" in ctx.build.title.lower() and ctx.build.event != "cron"):
|
||||
if not "full-ci" in ctx.build.title.lower() and ctx.build.event != "cron":
|
||||
return pipelines
|
||||
|
||||
storage = "posix"
|
||||
@@ -1455,7 +1411,7 @@ def multiServiceE2ePipeline(ctx):
|
||||
})
|
||||
return pipelines
|
||||
|
||||
def uploadTracingResult(ctx):
|
||||
def uploadTracingResult():
|
||||
return [{
|
||||
"name": "upload-tracing-result",
|
||||
"image": PLUGINS_S3,
|
||||
@@ -1549,7 +1505,7 @@ def dockerReleases(ctx):
|
||||
|
||||
def dockerRelease(ctx, repo, build_type):
|
||||
build_args = [
|
||||
"REVISION=%s" % (ctx.build.commit),
|
||||
"REVISION=%s" % ctx.build.commit,
|
||||
"VERSION=%s" % (ctx.build.ref.replace("refs/tags/", "") if ctx.build.event == "tag" else "daily"),
|
||||
]
|
||||
|
||||
@@ -1582,11 +1538,7 @@ def dockerRelease(ctx, repo, build_type):
|
||||
"from_secret": "ci_http_proxy",
|
||||
},
|
||||
},
|
||||
"when": [
|
||||
{
|
||||
"event": ["pull_request"],
|
||||
},
|
||||
],
|
||||
"when": [event["pull_request"]],
|
||||
},
|
||||
{
|
||||
"name": "build-and-push",
|
||||
@@ -1628,31 +1580,21 @@ def dockerRelease(ctx, repo, build_type):
|
||||
],
|
||||
},
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
{
|
||||
"event": "tag",
|
||||
},
|
||||
event["base"],
|
||||
event["tag"],
|
||||
],
|
||||
},
|
||||
],
|
||||
"depends_on": depends_on,
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
event["base"],
|
||||
{
|
||||
"event": "pull_request",
|
||||
"path": {
|
||||
"exclude": skipIfUnchanged(ctx, "build-docker"),
|
||||
},
|
||||
},
|
||||
{
|
||||
"event": "tag",
|
||||
},
|
||||
event["tag"],
|
||||
],
|
||||
}
|
||||
|
||||
@@ -1686,13 +1628,8 @@ def binaryRelease(ctx, arch, depends_on = []):
|
||||
"make -C opencloud release-finish",
|
||||
],
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
{
|
||||
"event": "tag",
|
||||
},
|
||||
event["base"],
|
||||
event["tag"],
|
||||
],
|
||||
},
|
||||
{
|
||||
@@ -1706,35 +1643,29 @@ def binaryRelease(ctx, arch, depends_on = []):
|
||||
"opencloud/dist/release/*",
|
||||
],
|
||||
"title": ctx.build.ref.replace("refs/tags/v", ""),
|
||||
"overwrite": True,
|
||||
"prerelease": len(ctx.build.ref.split("-")) > 1,
|
||||
},
|
||||
"when": [
|
||||
{
|
||||
"event": "tag",
|
||||
},
|
||||
event["tag"],
|
||||
],
|
||||
},
|
||||
],
|
||||
"depends_on": depends_on,
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
event["base"],
|
||||
{
|
||||
"event": "pull_request",
|
||||
"path": {
|
||||
"exclude": skipIfUnchanged(ctx, "build-binary"),
|
||||
},
|
||||
},
|
||||
{
|
||||
"event": "tag",
|
||||
},
|
||||
event["tag"],
|
||||
],
|
||||
}
|
||||
|
||||
def licenseCheck(ctx):
|
||||
environment = CI_HTTP_PROXY_ENV
|
||||
environment["GOBIN"] = "/woodpecker/src/github.com/opencloud-eu/opencloud/go/bin"
|
||||
return {
|
||||
"name": "check-licenses",
|
||||
"steps": restoreGoBinCache() + [
|
||||
@@ -1755,7 +1686,7 @@ def licenseCheck(ctx):
|
||||
{
|
||||
"name": "go-check-licenses",
|
||||
"image": OC_CI_GOLANG,
|
||||
"environment": CI_HTTP_PROXY_ENV,
|
||||
"environment": environment,
|
||||
"commands": [
|
||||
"make ci-go-check-licenses",
|
||||
],
|
||||
@@ -1763,7 +1694,7 @@ def licenseCheck(ctx):
|
||||
{
|
||||
"name": "go-save-licenses",
|
||||
"image": OC_CI_GOLANG,
|
||||
"environment": CI_HTTP_PROXY_ENV,
|
||||
"environment": environment,
|
||||
"commands": [
|
||||
"make ci-go-save-licenses",
|
||||
],
|
||||
@@ -1786,29 +1717,18 @@ def licenseCheck(ctx):
|
||||
"third-party-licenses.tar.gz",
|
||||
],
|
||||
"title": ctx.build.ref.replace("refs/tags/v", ""),
|
||||
"overwrite": True,
|
||||
"prerelease": len(ctx.build.ref.split("-")) > 1,
|
||||
},
|
||||
"when": [
|
||||
{
|
||||
"event": "tag",
|
||||
},
|
||||
event["tag"],
|
||||
],
|
||||
},
|
||||
],
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
{
|
||||
"event": "pull_request",
|
||||
},
|
||||
{
|
||||
"event": "tag",
|
||||
},
|
||||
event["base"],
|
||||
event["pull_request"],
|
||||
event["tag"],
|
||||
],
|
||||
"workspace": workspace,
|
||||
}
|
||||
|
||||
def readyReleaseGo():
|
||||
@@ -1827,12 +1747,7 @@ def readyReleaseGo():
|
||||
},
|
||||
},
|
||||
],
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
],
|
||||
"when": [event["base"]],
|
||||
}]
|
||||
|
||||
def releaseDockerReadme(repo, build_type):
|
||||
@@ -1850,7 +1765,7 @@ def releaseDockerReadme(repo, build_type):
|
||||
"from_secret": "docker_password",
|
||||
},
|
||||
"PUSHRM_TARGET": repo,
|
||||
"PUSHRM_SHORT": "Docker images for %s" % (repo),
|
||||
"PUSHRM_SHORT": "Docker images for %s" % repo,
|
||||
"PUSHRM_FILE": "README.md",
|
||||
},
|
||||
},
|
||||
@@ -1868,13 +1783,8 @@ def releaseDockerReadme(repo, build_type):
|
||||
},
|
||||
],
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
{
|
||||
"event": "tag",
|
||||
},
|
||||
event["base"],
|
||||
event["tag"],
|
||||
],
|
||||
}
|
||||
|
||||
@@ -1910,17 +1820,17 @@ def makeNodeGenerate(module):
|
||||
if module == "":
|
||||
make = "make"
|
||||
else:
|
||||
make = "make -C %s" % (module)
|
||||
make = "make -C %s" % module
|
||||
return [
|
||||
{
|
||||
"name": "generate nodejs",
|
||||
"name": "generate-nodejs",
|
||||
"image": OC_CI_NODEJS % DEFAULT_NODEJS_VERSION,
|
||||
"environment": {
|
||||
"CHROMEDRIVER_SKIP_DOWNLOAD": True, # install fails on arm and chromedriver is a test only dependency
|
||||
},
|
||||
"commands": [
|
||||
"pnpm config set store-dir ./.pnpm-store",
|
||||
"for i in $(seq 3); do %s node-generate-prod && break || sleep 1; done" % (make),
|
||||
"for i in $(seq 3); do %s node-generate-prod && break || sleep 1; done" % make,
|
||||
],
|
||||
},
|
||||
]
|
||||
@@ -1929,13 +1839,13 @@ def makeGoGenerate(module):
|
||||
if module == "":
|
||||
make = "make"
|
||||
else:
|
||||
make = "make -C %s" % (module)
|
||||
make = "make -C %s" % module
|
||||
return [
|
||||
{
|
||||
"name": "generate go",
|
||||
"name": "generate-go",
|
||||
"image": OC_CI_GOLANG,
|
||||
"commands": [
|
||||
"for i in $(seq 3); do %s go-generate && break || sleep 1; done" % (make),
|
||||
"for i in $(seq 3); do %s go-generate && break || sleep 1; done" % make,
|
||||
],
|
||||
"environment": CI_HTTP_PROXY_ENV,
|
||||
},
|
||||
@@ -1967,20 +1877,18 @@ def notify(ctx):
|
||||
"event": ["push", "manual"],
|
||||
"branch": ["main", "release-*"],
|
||||
},
|
||||
{
|
||||
"event": "tag",
|
||||
},
|
||||
event["tag"],
|
||||
],
|
||||
"runs_on": status,
|
||||
}
|
||||
|
||||
def opencloudServer(storage = "decomposed", accounts_hash_difficulty = 4, volumes = [], depends_on = [], deploy_type = "", extra_server_environment = {}, with_wrapper = False, tika_enabled = False):
|
||||
def opencloudServer(storage = "decomposed", accounts_hash_difficulty = 4, depends_on = [], deploy_type = "", extra_server_environment = {}, with_wrapper = False, tika_enabled = False):
|
||||
user = "0:0"
|
||||
container_name = OC_SERVER_NAME
|
||||
environment = {
|
||||
"OC_URL": OC_URL,
|
||||
"OC_CONFIG_DIR": "/root/.opencloud/config", # needed for checking config later
|
||||
"STORAGE_USERS_DRIVER": "%s" % (storage),
|
||||
"STORAGE_USERS_DRIVER": "%s" % storage,
|
||||
"PROXY_ENABLE_BASIC_AUTH": True,
|
||||
"WEB_UI_CONFIG_FILE": "%s/%s" % (dirs["base"], dirs["opencloudConfig"]),
|
||||
"OC_LOG_LEVEL": "error",
|
||||
@@ -2070,20 +1978,27 @@ def opencloudServer(storage = "decomposed", accounts_hash_difficulty = 4, volume
|
||||
# That will allow OpenCloud to use whatever its built-in default is.
|
||||
# Otherwise pass in a value from 4 to about 11 or 12 (default 4, for making regular tests fast)
|
||||
# The high values cause lots of CPU to be used when hashing passwords, and really slow down the tests.
|
||||
if (accounts_hash_difficulty != "default"):
|
||||
if accounts_hash_difficulty != "default":
|
||||
environment["ACCOUNTS_HASH_DIFFICULTY"] = accounts_hash_difficulty
|
||||
|
||||
for item in extra_server_environment:
|
||||
environment[item] = extra_server_environment[item]
|
||||
|
||||
wrapper_commands = [
|
||||
"make -C %s build" % dirs["ocWrapper"],
|
||||
server_commands = [
|
||||
"env | sort",
|
||||
"%s/bin/ocwrapper serve --bin %s --url %s --admin-username admin --admin-password admin" % (dirs["ocWrapper"], dirs["opencloudBin"], environment["OC_URL"]),
|
||||
]
|
||||
if with_wrapper:
|
||||
server_commands += [
|
||||
"make -C %s build" % dirs["ocWrapper"],
|
||||
"%s/bin/ocwrapper serve --bin %s --url %s --admin-username admin --admin-password admin" % (dirs["ocWrapper"], dirs["opencloudBin"], environment["OC_URL"]),
|
||||
]
|
||||
else:
|
||||
server_commands += [
|
||||
"%s server" % dirs["opencloudBin"],
|
||||
]
|
||||
|
||||
wait_for_opencloud = {
|
||||
"name": "wait-for-%s" % (container_name),
|
||||
"name": "wait-for-%s" % container_name,
|
||||
"image": OC_CI_ALPINE,
|
||||
"commands": [
|
||||
# wait for opencloud-server to be ready (5 minutes)
|
||||
@@ -2107,7 +2022,7 @@ def opencloudServer(storage = "decomposed", accounts_hash_difficulty = 4, volume
|
||||
"%s init --insecure true" % dirs["opencloudBin"],
|
||||
"cat $OC_CONFIG_DIR/opencloud.yaml",
|
||||
"cp tests/config/woodpecker/app-registry.yaml $OC_CONFIG_DIR/app-registry.yaml",
|
||||
] + (wrapper_commands),
|
||||
] + server_commands,
|
||||
}
|
||||
|
||||
steps = [
|
||||
@@ -2179,11 +2094,6 @@ def build():
|
||||
]
|
||||
|
||||
def skipIfUnchanged(ctx, type):
|
||||
## FIXME: the 'exclude' feature (https://woodpecker-ci.org/docs/usage/workflow-syntax#path) does not seem to provide
|
||||
# what we need. It seems to skip the build as soon as one of the changed files matches an exclude pattern, we only
|
||||
# want to skip of ALL changed files match. So skip this condition for now:
|
||||
return []
|
||||
|
||||
if "full-ci" in ctx.build.title.lower() or ctx.build.event == "tag" or ctx.build.event == "cron":
|
||||
return []
|
||||
|
||||
@@ -2213,8 +2123,6 @@ def skipIfUnchanged(ctx, type):
|
||||
skip = base + unit + acceptance
|
||||
elif type == "cache":
|
||||
skip = base
|
||||
else:
|
||||
return []
|
||||
|
||||
return skip
|
||||
|
||||
@@ -2246,13 +2154,13 @@ def example_deploys(ctx):
|
||||
|
||||
deploys = []
|
||||
for config in configs:
|
||||
deploys.append(deploy(ctx, config, rebuild))
|
||||
deploys.append(deploy(config, rebuild))
|
||||
|
||||
return deploys
|
||||
|
||||
def deploy(ctx, config, rebuild):
|
||||
def deploy(config, rebuild):
|
||||
return {
|
||||
"name": "deploy_%s" % (config),
|
||||
"name": "deploy_%s" % config,
|
||||
"steps": [
|
||||
{
|
||||
"name": "clone continuous deployment playbook",
|
||||
@@ -2267,7 +2175,7 @@ def deploy(ctx, config, rebuild):
|
||||
"image": OC_CI_DRONE_ANSIBLE,
|
||||
"failure": "ignore",
|
||||
"environment": {
|
||||
"CONTINUOUS_DEPLOY_SERVERS_CONFIG": "../%s" % (config),
|
||||
"CONTINUOUS_DEPLOY_SERVERS_CONFIG": "../%s" % config,
|
||||
"REBUILD": rebuild,
|
||||
"HCLOUD_API_TOKEN": {
|
||||
"from_secret": "hcloud_api_token",
|
||||
@@ -2288,13 +2196,8 @@ def deploy(ctx, config, rebuild):
|
||||
},
|
||||
],
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
{
|
||||
"event": "tag",
|
||||
},
|
||||
event["base"],
|
||||
event["tag"],
|
||||
],
|
||||
}
|
||||
|
||||
@@ -2324,11 +2227,7 @@ def checkStarlark():
|
||||
},
|
||||
],
|
||||
"depends_on": [],
|
||||
"when": [
|
||||
{
|
||||
"event": "pull_request",
|
||||
},
|
||||
],
|
||||
"when": [event["pull_request"]],
|
||||
}]
|
||||
|
||||
def genericCache(name, action, mounts, cache_path):
|
||||
@@ -2357,7 +2256,7 @@ def genericCache(name, action, mounts, cache_path):
|
||||
"secret_key": {
|
||||
"from_secret": "cache_s3_secret_key",
|
||||
},
|
||||
"filename": "%s.tar" % (name),
|
||||
"filename": "%s.tar" % name,
|
||||
"path": cache_path,
|
||||
"fallback_path": cache_path,
|
||||
},
|
||||
@@ -2388,13 +2287,8 @@ def genericCachePurge(flush_path):
|
||||
},
|
||||
],
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
{
|
||||
"event": "pull_request",
|
||||
},
|
||||
event["base"],
|
||||
event["pull_request"],
|
||||
],
|
||||
"runs_on": ["success", "failure"],
|
||||
}
|
||||
@@ -2402,7 +2296,7 @@ def genericCachePurge(flush_path):
|
||||
def genericBuildArtifactCache(ctx, name, action, path):
|
||||
if action == "rebuild" or action == "restore":
|
||||
cache_path = "%s/%s/%s" % ("cache", repo_slug, ctx.build.commit + "-${CI_PIPELINE_NUMBER}")
|
||||
name = "%s_build_artifact_cache" % (name)
|
||||
name = "%s_build_artifact_cache" % name
|
||||
return genericCache(name, action, [path], cache_path)
|
||||
|
||||
if action == "purge":
|
||||
@@ -2419,14 +2313,13 @@ def rebuildBuildArtifactCache(ctx, name, path):
|
||||
def purgeBuildArtifactCache(ctx):
|
||||
return genericBuildArtifactCache(ctx, "", "purge", [])
|
||||
|
||||
def pipelineSanityChecks(ctx, pipelines):
|
||||
def pipelineSanityChecks(pipelines):
|
||||
"""pipelineSanityChecks helps the CI developers to find errors before running it
|
||||
|
||||
These sanity checks are only executed on when converting starlark to yaml.
|
||||
Error outputs are only visible when the conversion is done with the woodpecker cli.
|
||||
|
||||
Args:
|
||||
ctx: woodpecker passes a context with information which the pipeline can be adapted to
|
||||
pipelines: pipelines to be checked, normally you should run this on the return value of main()
|
||||
|
||||
Returns:
|
||||
@@ -2438,7 +2331,7 @@ def pipelineSanityChecks(ctx, pipelines):
|
||||
for pipeline in pipelines:
|
||||
pipeline_name = pipeline["name"]
|
||||
if len(pipeline_name) > max_name_length:
|
||||
print("Error: pipeline name %s is longer than 50 characters" % (pipeline_name))
|
||||
print("Error: pipeline name %s is longer than 50 characters" % pipeline_name)
|
||||
|
||||
for step in pipeline["steps"]:
|
||||
step_name = step["name"]
|
||||
@@ -2489,7 +2382,7 @@ def pipelineSanityChecks(ctx, pipelines):
|
||||
def litmus(ctx, storage):
|
||||
pipelines = []
|
||||
|
||||
if (config["litmus"] == False):
|
||||
if not config["litmus"]:
|
||||
return pipelines
|
||||
|
||||
environment = {
|
||||
@@ -2574,10 +2467,7 @@ def litmus(ctx, storage):
|
||||
"services": redisForOCStorage(storage),
|
||||
"depends_on": getPipelineNames(buildOpencloudBinaryForTesting(ctx)),
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
event["base"],
|
||||
{
|
||||
"event": "pull_request",
|
||||
"path": {
|
||||
|
||||
@@ -1,16 +0,0 @@
|
||||
---
|
||||
|
||||
when:
|
||||
- event: ["push", "manual"]
|
||||
branch: main
|
||||
|
||||
steps:
|
||||
- name: devdocs
|
||||
image: codeberg.org/xfix/plugin-codeberg-pages-deploy:1
|
||||
settings:
|
||||
folder: docs
|
||||
branch: docs
|
||||
git_config_email: ${CI_COMMIT_AUTHOR_EMAIL}
|
||||
git_config_name: ${CI_COMMIT_AUTHOR}
|
||||
ssh_key:
|
||||
from_secret: ssh_key
|
||||
41
CHANGELOG.md
41
CHANGELOG.md
@@ -1,5 +1,46 @@
|
||||
# Changelog
|
||||
|
||||
## [2.1.0](https://github.com/opencloud-eu/opencloud/releases/tag/v2.1.0) - 2025-04-07
|
||||
|
||||
### ❤️ Thanks to all contributors! ❤️
|
||||
|
||||
@AlexAndBear, @JammingBen, @ScharfViktor, @aduffeck, @butonic, @fschade, @individual-it, @kulmann, @micbar, @michaelstingl, @rhafer
|
||||
|
||||
### 🐛 Bug Fixes
|
||||
|
||||
- feat(antivirus): add partial scanning mode [[#559](https://github.com/opencloud-eu/opencloud/pull/559)]
|
||||
- Simplify item-trashed SSEs. Also fixes it for coll. posix fs. [[#565](https://github.com/opencloud-eu/opencloud/pull/565)]
|
||||
- fix(opencloud_full): add missing SMTP env vars [[#563](https://github.com/opencloud-eu/opencloud/pull/563)]
|
||||
- fix: full deployment tika description is wrong [[#553](https://github.com/opencloud-eu/opencloud/pull/553)]
|
||||
- fix: traefik credentials [[#555](https://github.com/opencloud-eu/opencloud/pull/555)]
|
||||
- Enable scan/watch in the storageprovider only [[#546](https://github.com/opencloud-eu/opencloud/pull/546)]
|
||||
- fix: typo in dev docs [[#540](https://github.com/opencloud-eu/opencloud/pull/540)]
|
||||
|
||||
### 📈 Enhancement
|
||||
|
||||
- [full-ci] reva bump 2.31.0 [[#599](https://github.com/opencloud-eu/opencloud/pull/599)]
|
||||
- feat: support svg as icon [[#538](https://github.com/opencloud-eu/opencloud/pull/538)]
|
||||
- feat: change theme.json primary color [[#536](https://github.com/opencloud-eu/opencloud/pull/536)]
|
||||
- graph: reduce memory allocations [[#494](https://github.com/opencloud-eu/opencloud/pull/494)]
|
||||
|
||||
### ✅ Tests
|
||||
|
||||
- [full-ci] fix expected spanish string in test [[#596](https://github.com/opencloud-eu/opencloud/pull/596)]
|
||||
- Revert "Disable the 'exclude' patterns on the path conditional for now" [[#561](https://github.com/opencloud-eu/opencloud/pull/561)]
|
||||
|
||||
### 📦️ Dependencies
|
||||
|
||||
- build(deps): bump github.com/go-playground/validator/v10 from 10.25.0 to 10.26.0 [[#571](https://github.com/opencloud-eu/opencloud/pull/571)]
|
||||
- build(deps): bump github.com/nats-io/nats.go from 1.39.1 to 1.41.0 [[#567](https://github.com/opencloud-eu/opencloud/pull/567)]
|
||||
- [full-ci] chore(web): bump web to v2.2.0 [[#570](https://github.com/opencloud-eu/opencloud/pull/570)]
|
||||
- build(deps): bump github.com/onsi/gomega from 1.36.3 to 1.37.0 [[#566](https://github.com/opencloud-eu/opencloud/pull/566)]
|
||||
- build(deps): bump golang.org/x/net from 0.37.0 to 0.38.0 [[#557](https://github.com/opencloud-eu/opencloud/pull/557)]
|
||||
- build(deps-dev): bump eslint-plugin-jsx-a11y from 6.9.0 to 6.10.2 in /services/idp [[#542](https://github.com/opencloud-eu/opencloud/pull/542)]
|
||||
- build(deps): bump web-vitals from 3.5.2 to 4.2.4 in /services/idp [[#541](https://github.com/opencloud-eu/opencloud/pull/541)]
|
||||
- build(deps): bump github.com/open-policy-agent/opa from 1.2.0 to 1.3.0 [[#508](https://github.com/opencloud-eu/opencloud/pull/508)]
|
||||
- build(deps): bump github.com/urfave/cli/v2 from 2.27.5 to 2.27.6 [[#509](https://github.com/opencloud-eu/opencloud/pull/509)]
|
||||
- fix keycloak example #465 [[#535](https://github.com/opencloud-eu/opencloud/pull/535)]
|
||||
|
||||
## [2.0.0](https://github.com/opencloud-eu/opencloud/releases/tag/v2.0.0) - 2025-03-26
|
||||
|
||||
### ❤️ Thanks to all contributors! ❤️
|
||||
|
||||
@@ -26,14 +26,26 @@ This script should **NOT** be run as user root.
|
||||
Set the environment variable `OC_VERSION` to the version you want
|
||||
to download. If not set, there is a reasonable default.
|
||||
|
||||
## Data Location
|
||||
|
||||
Set the environment variable `OC_BASE_DIR` to a directory where the
|
||||
`data` and `config` subdirectories shall be located. Per default,
|
||||
both configuration and storage data are within a sandbox subdirectory
|
||||
in the current working directory.
|
||||
|
||||
## Server Address
|
||||
|
||||
Set the environment variable `OC_HOST` to the fully qualified hostname
|
||||
of this server to allow remote accesse. Default: `localhost`.
|
||||
|
||||
# Example
|
||||
|
||||
Call
|
||||
|
||||
```
|
||||
OC_VERSION="1.0.0" ./install.sh
|
||||
OC_VERSION="2.0.0" ./install.sh
|
||||
```
|
||||
to install the OpenCloud version 1.0.0
|
||||
to install the OpenCloud version 2.0.0
|
||||
|
||||
There is also a hosted version of this script that makes it even
|
||||
easier:
|
||||
|
||||
@@ -37,7 +37,7 @@ function backup_file () {
|
||||
# URL pattern of the download file
|
||||
# https://github.com/opencloud-eu/opencloud/releases/download/v1.0.0/opencloud-1.0.0-linux-amd64
|
||||
|
||||
dlversion="${OC_VERSION:-1.1.0}"
|
||||
dlversion="${OC_VERSION:-2.0.0}"
|
||||
dlurl="https://github.com/opencloud-eu/opencloud/releases/download/v${dlversion}/"
|
||||
|
||||
sandbox="opencloud-sandbox-${dlversion}"
|
||||
@@ -69,14 +69,14 @@ echo "Downloading ${dlurl}/${dlfile}"
|
||||
curl -L -o "${dlfile}" --progress-bar "${dlurl}/${dlfile}"
|
||||
chmod 755 ${dlfile}
|
||||
|
||||
mkdir data config
|
||||
|
||||
export OC_CONFIG_DIR="$(pwd)/config"
|
||||
export OC_BASE_DATA_PATH="$(pwd)/data"
|
||||
basedir="${OC_BASE_DIR:-$(pwd)}"
|
||||
export OC_CONFIG_DIR="$basedir/config"
|
||||
export OC_BASE_DATA_PATH="$basedir/data"
|
||||
mkdir -p "$OC_CONFIG_DIR" "$OC_BASE_DATA_PATH"
|
||||
|
||||
# It is bound to localhost for now to deal with non existing routes
|
||||
# to certain host names for example in WSL
|
||||
host="localhost"
|
||||
host="${OC_HOST:-localhost}"
|
||||
|
||||
./${dlfile} init --insecure yes --ap admin
|
||||
|
||||
|
||||
@@ -17,7 +17,9 @@ TRAEFIK_DASHBOARD=
|
||||
# Defaults to "traefik.opencloud.test"
|
||||
TRAEFIK_DOMAIN=
|
||||
# Basic authentication for the traefik dashboard.
|
||||
# Defaults to user "admin" and password "admin" (written as: "admin:admin").
|
||||
# Defaults to user "admin" and password "admin" (written as: "admin:$2y$05$KDHu3xq92SPaO3G8Ybkc7edd51pPLJcG1nWk3lmlrIdANQ/B6r5pq").
|
||||
# To create user:password pair, it's possible to use this command:
|
||||
# echo $(htpasswd -nB user) | sed -e s/\\$/\\$\\$/g
|
||||
TRAEFIK_BASIC_AUTH_USERS=
|
||||
# Email address for obtaining LetsEncrypt certificates.
|
||||
# Needs only be changed if this is a public facing server.
|
||||
@@ -62,6 +64,8 @@ LOG_LEVEL=
|
||||
# LOG_PRETTY=true
|
||||
#
|
||||
# Define the openCloud storage location. Set the paths for config and data to a local path.
|
||||
# Ensure that the configuration and data directories are owned by the user and group with ID 1000:1000.
|
||||
# This matches the default user inside the container and avoids permission issues when accessing files.
|
||||
# Note that especially the data directory can grow big.
|
||||
# Leaving it default stores data in docker internal volumes.
|
||||
# OC_CONFIG_DIR=/your/local/opencloud/config
|
||||
@@ -98,8 +102,8 @@ MINIO_DOMAIN=
|
||||
# Note: the leading colon is required to enable the service.
|
||||
#DECOMPOSED=:decomposed.yml
|
||||
|
||||
# Define SMPT settings if you would like to send OpenCloud email notifications.
|
||||
#
|
||||
# Define SMTP settings if you would like to send OpenCloud email notifications.
|
||||
#
|
||||
# NOTE: when configuring Inbucket, these settings have no effect, see inbucket.yml for details.
|
||||
# SMTP host to connect to.
|
||||
SMTP_HOST=
|
||||
@@ -114,6 +118,8 @@ SMTP_USERNAME=
|
||||
SMTP_PASSWORD=
|
||||
# Authentication method for the SMTP communication.
|
||||
SMTP_AUTHENTICATION=
|
||||
# Encryption method for the SMTP communication. Possible values are 'starttls', 'ssltls' and 'none'
|
||||
SMTP_TRANSPORT_ENCRYPTION=
|
||||
# Allow insecure connections to the SMTP server. Defaults to false.
|
||||
SMTP_INSECURE=
|
||||
|
||||
@@ -157,7 +163,7 @@ COMPANION_ONEDRIVE_SECRET=
|
||||
## Default Enabled Services ##
|
||||
|
||||
### Apache Tika Content Analysis Toolkit ###
|
||||
# Tika (search) is enabled by default, comment if not required.
|
||||
# Tika (search) is disabled by default due to performance reasons.
|
||||
# Note: the leading colon is required to enable the service.
|
||||
#TIKA=:tika.yml
|
||||
# Set the desired docker image tag or digest.
|
||||
@@ -210,6 +216,13 @@ COLLABORA_SSL_VERIFICATION=false
|
||||
# envvar in the OpenCloud Settings above by adding 'antivirus' to the list.
|
||||
# Note: the leading colon is required to enable the service.
|
||||
#CLAMAV=:clamav.yml
|
||||
# The maximum scan size the virus scanner can handle, needs adjustment in the scanner config as well.
|
||||
# Usable common abbreviations: [KB, KiB, MB, MiB, GB, GiB, TB, TiB, PB, PiB, EB, EiB], example: 2GB.
|
||||
# Defaults to "100MB"
|
||||
#ANTIVIRUS_MAX_SCAN_SIZE=
|
||||
# Usable modes: partial, skip.
|
||||
# Defaults to "partial"
|
||||
#ANTIVIRUS_MAX_SCAN_SIZE_MODE=
|
||||
# Image version of the ClamAV container.
|
||||
# Defaults to "latest"
|
||||
CLAMAV_DOCKER_TAG=
|
||||
@@ -237,8 +250,31 @@ INBUCKET_DOMAIN=
|
||||
# Path separator for supplemental compose files specified in COMPOSE_FILE.
|
||||
COMPOSE_PATH_SEPARATOR=:
|
||||
|
||||
### Keycloak Settings ###
|
||||
# Note: the leading colon is required to enable the service.
|
||||
#KEYCLOAK=:keycloak.yml
|
||||
# Domain for Keycloak. Defaults to "keycloak.opencloud.test".
|
||||
KEYCLOAK_DOMAIN=
|
||||
# Realm which to be used with OpenCloud. Defaults to "OpenCloud"
|
||||
KEYCLOAK_REALM=
|
||||
# Admin user login name. Defaults to "admin"
|
||||
KEYCLOAK_ADMIN_USER=
|
||||
# Admin user login password. Defaults to "admin"
|
||||
KEYCLOAK_ADMIN_PASSWORD=
|
||||
|
||||
### Ldap Settings ###
|
||||
# Note: the leading colon is required to enable the service.
|
||||
#LDAP=:ldap.yml
|
||||
# Password of LDAP user "cn=admin,dc=opencloud,dc=eu". Defaults to "admin"
|
||||
LDAP_ADMIN_PASSWORD=
|
||||
# LDAP manager
|
||||
# login with uid ldapadmin and password
|
||||
#LDAP_MANAGER=:../shared/config/ldap/docker-compose.yml
|
||||
# LDAP manager domain. Defaults to "ldap.opencloud.test"
|
||||
LDAP_MANAGER_DOMAIN=
|
||||
|
||||
## IMPORTANT ##
|
||||
# This MUST be the last line as it assembles the supplemental compose files to be used.
|
||||
# ALL supplemental configs must be added here, whether commented or not.
|
||||
# Each var must either be empty or contain :path/file.yml
|
||||
COMPOSE_FILE=docker-compose.yml${OPENCLOUD:-}${TIKA:-}${DECOMPOSEDS3:-}${DECOMPOSEDS3_MINIO:-}${DECOMPOSED:-}${COLLABORA:-}${MONITORING:-}${IMPORTER:-}${CLAMAV:-}${ONLYOFFICE:-}${INBUCKET:-}${EXTENSIONS:-}${UNZIP:-}${DRAWIO:-}${JSONVIEWER:-}${PROGRESSBARS:-}${EXTERNALSITES:-}
|
||||
COMPOSE_FILE=docker-compose.yml${OPENCLOUD:-}${TIKA:-}${DECOMPOSEDS3:-}${DECOMPOSEDS3_MINIO:-}${DECOMPOSED:-}${COLLABORA:-}${MONITORING:-}${IMPORTER:-}${CLAMAV:-}${ONLYOFFICE:-}${INBUCKET:-}${EXTENSIONS:-}${UNZIP:-}${DRAWIO:-}${JSONVIEWER:-}${PROGRESSBARS:-}${EXTERNALSITES:-}${KEYCLOAK:-}${LDAP:-}${LDAP_MANAGER:-}
|
||||
|
||||
@@ -4,6 +4,8 @@ services:
|
||||
environment:
|
||||
ANTIVIRUS_SCANNER_TYPE: "clamav"
|
||||
ANTIVIRUS_CLAMAV_SOCKET: "/var/run/clamav/clamd.sock"
|
||||
ANTIVIRUS_MAX_SCAN_SIZE_MODE: ${ANTIVIRUS_MAX_SCAN_SIZE_MODE:-partial}
|
||||
ANTIVIRUS_MAX_SCAN_SIZE: ${ANTIVIRUS_MAX_SCAN_SIZE:-100MB}
|
||||
# the antivirus service needs manual startup, see .env and opencloud.yaml for START_ADDITIONAL_SERVICES
|
||||
# configure the antivirus service
|
||||
POSTPROCESSING_STEPS: "virusscan"
|
||||
|
||||
@@ -0,0 +1,63 @@
|
||||
{
|
||||
"clientId": "OpenCloudAndroid",
|
||||
"name": "OpenCloud Android App",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"oc://android.opencloud.eu"
|
||||
],
|
||||
"webOrigins": [],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"post.logout.redirect.uris": "oc://android.opencloud.eu",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -0,0 +1,64 @@
|
||||
{
|
||||
"clientId": "OpenCloudDesktop",
|
||||
"name": "OpenCloud Desktop Client",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"http://127.0.0.1",
|
||||
"http://localhost"
|
||||
],
|
||||
"webOrigins": [],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"post.logout.redirect.uris": "+",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -0,0 +1,63 @@
|
||||
{
|
||||
"clientId": "OpenCloudIOS",
|
||||
"name": "OpenCloud iOS App",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"oc://ios.opencloud.eu"
|
||||
],
|
||||
"webOrigins": [],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"post.logout.redirect.uris": "oc://ios.opencloud.eu",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -0,0 +1,66 @@
|
||||
{
|
||||
"clientId": "Cyberduck",
|
||||
"name": "Cyberduck",
|
||||
"description": "File transfer utility client",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"x-cyberduck-action:oauth",
|
||||
"x-mountainduck-action:oauth"
|
||||
],
|
||||
"webOrigins": [],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"oauth2.device.authorization.grant.enabled": "false",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"oidc.ciba.grant.enabled": "false",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -0,0 +1,74 @@
|
||||
{
|
||||
"clientId": "web",
|
||||
"name": "OpenCloud Web App",
|
||||
"description": "",
|
||||
"rootUrl": "{{OC_URL}}",
|
||||
"adminUrl": "{{OC_URL}}",
|
||||
"baseUrl": "",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"{{OC_URL}}/",
|
||||
"{{OC_URL}}/oidc-callback.html",
|
||||
"{{OC_URL}}/oidc-silent-redirect.html"
|
||||
],
|
||||
"webOrigins": [
|
||||
"{{OC_URL}}"
|
||||
],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"post.logout.redirect.uris": "+",
|
||||
"oauth2.device.authorization.grant.enabled": "false",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"oidc.ciba.grant.enabled": "false",
|
||||
"backchannel.logout.url": "{{OC_URL}}/backchannel_logout",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -0,0 +1,8 @@
|
||||
#!/bin/bash
|
||||
printenv
|
||||
# replace openCloud domain in keycloak realm import
|
||||
mkdir /opt/keycloak/data/import
|
||||
sed -e "s/cloud.opencloud.test/${OC_DOMAIN}/g" /opt/keycloak/data/import-dist/opencloud-realm.json > /opt/keycloak/data/import/opencloud-realm.json
|
||||
|
||||
# run original docker-entrypoint
|
||||
/opt/keycloak/bin/kc.sh "$@"
|
||||
File diff suppressed because it is too large
Load Diff
@@ -0,0 +1,9 @@
|
||||
#!/bin/bash
|
||||
printenv
|
||||
|
||||
if [ ! -f /opt/bitnami/openldap/share/openldap.key ]
|
||||
then
|
||||
openssl req -x509 -newkey rsa:4096 -keyout /opt/bitnami/openldap/share/openldap.key -out /opt/bitnami/openldap/share/openldap.crt -sha256 -days 365 -batch -nodes
|
||||
fi
|
||||
# run original docker-entrypoint
|
||||
/opt/bitnami/scripts/openldap/entrypoint.sh "$@"
|
||||
@@ -0,0 +1,20 @@
|
||||
dn: dc=opencloud,dc=eu
|
||||
objectClass: organization
|
||||
objectClass: dcObject
|
||||
dc: opencloud
|
||||
o: openCloud
|
||||
|
||||
dn: ou=users,dc=opencloud,dc=eu
|
||||
objectClass: organizationalUnit
|
||||
ou: users
|
||||
|
||||
dn: cn=admin,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: person
|
||||
cn: admin
|
||||
sn: admin
|
||||
uid: ldapadmin
|
||||
|
||||
dn: ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: organizationalUnit
|
||||
ou: groups
|
||||
@@ -0,0 +1,125 @@
|
||||
# Start dn with uid (user identifier / login), not cn (Firstname + Surname)
|
||||
dn: uid=alan,ou=users,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: organizationalPerson
|
||||
objectClass: openCloudUser
|
||||
objectClass: person
|
||||
objectClass: posixAccount
|
||||
objectClass: top
|
||||
uid: alan
|
||||
givenName: Alan
|
||||
sn: Turing
|
||||
cn: alan
|
||||
displayName: Alan Turing
|
||||
description: An English mathematician, computer scientist, logician, cryptanalyst, philosopher and theoretical biologist. He was highly influential in the development of theoretical computer science, providing a formalisation of the concepts of algorithm and computation with the Turing machine.
|
||||
mail: alan@example.org
|
||||
uidNumber: 20000
|
||||
gidNumber: 30000
|
||||
homeDirectory: /home/alan
|
||||
openCloudUUID: b1f74ec4-dd7e-11ef-a543-03775734d0f7
|
||||
userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
|
||||
|
||||
dn: uid=lynn,ou=users,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: organizationalPerson
|
||||
objectClass: openCloudUser
|
||||
objectClass: person
|
||||
objectClass: posixAccount
|
||||
objectClass: top
|
||||
uid: lynn
|
||||
givenName: Lynn
|
||||
sn: Conway
|
||||
cn: lynn
|
||||
displayName: Lynn Conway
|
||||
description: An American computer scientist, electrical engineer, and transgender activist.
|
||||
mail: lynn@example.org
|
||||
uidNumber: 20001
|
||||
gidNumber: 30000
|
||||
homeDirectory: /home/lynn
|
||||
openCloudUserEnabled: TRUE
|
||||
openCloudUUID: 60708dda-e897-11ef-919f-bbb7437d6ec2
|
||||
userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
|
||||
|
||||
dn: uid=mary,ou=users,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: organizationalPerson
|
||||
objectClass: openCloudUser
|
||||
objectClass: person
|
||||
objectClass: posixAccount
|
||||
objectClass: top
|
||||
uid: mary
|
||||
givenName: Mary
|
||||
sn: Kenneth Keller
|
||||
cn: mary
|
||||
displayName: Mary Kenneth Keller
|
||||
description: Mary Kenneth Keller of the Sisters of Charity of the Blessed Virgin Mary was a pioneer in computer science.
|
||||
mail: mary@example.org
|
||||
uidNumber: 20002
|
||||
gidNumber: 30000
|
||||
homeDirectory: /home/mary
|
||||
openCloudUserEnabled: TRUE
|
||||
openCloudUUID: 056fc874-dd7f-11ef-ba84-af6fca4b7289
|
||||
userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
|
||||
|
||||
dn: uid=margaret,ou=users,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: organizationalPerson
|
||||
objectClass: openCloudUser
|
||||
objectClass: person
|
||||
objectClass: posixAccount
|
||||
objectClass: top
|
||||
uid: margaret
|
||||
givenName: Margaret
|
||||
sn: Hamilton
|
||||
cn: margaret
|
||||
displayName: Margaret Hamilton
|
||||
description: A director of the Software Engineering Division of the MIT Instrumentation Laboratory, which developed on-board flight software for NASA's Apollo program.
|
||||
mail: margaret@example.org
|
||||
uidNumber: 20003
|
||||
gidNumber: 30000
|
||||
homeDirectory: /home/margaret
|
||||
openCloudUserEnabled: TRUE
|
||||
openCloudUUID: 801abee4-dd7f-11ef-a324-83f55a754b62
|
||||
userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
|
||||
|
||||
dn: uid=dennis,ou=users,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: organizationalPerson
|
||||
objectClass: openCloudUser
|
||||
objectClass: person
|
||||
objectClass: posixAccount
|
||||
objectClass: top
|
||||
uid: dennis
|
||||
givenName: Dennis
|
||||
sn: Ritchie
|
||||
cn: dennis
|
||||
displayName: Dennis Ritchie
|
||||
description: American computer scientist. He created the C programming language and the Unix operating system and B language with long-time colleague Ken Thompson.
|
||||
mail: dennis@example.org
|
||||
uidNumber: 20004
|
||||
gidNumber: 30000
|
||||
homeDirectory: /home/dennis
|
||||
openCloudUserEnabled: TRUE
|
||||
openCloudUUID: cd88bf9a-dd7f-11ef-a609-7f78deb2345f
|
||||
userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
|
||||
|
||||
dn: uid=admin,ou=users,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: organizationalPerson
|
||||
objectClass: openCloudUser
|
||||
objectClass: person
|
||||
objectClass: posixAccount
|
||||
objectClass: top
|
||||
uid: admin
|
||||
givenName: Admin
|
||||
sn: Admin
|
||||
cn: admin
|
||||
displayName: Admin
|
||||
description: An admin for this OpenCloud instance.
|
||||
mail: admin@example.org
|
||||
uidNumber: 20005
|
||||
gidNumber: 30000
|
||||
homeDirectory: /home/admin
|
||||
openCloudUserEnabled: TRUE
|
||||
openCloudUUID: f7fc96f6-ceb4-4387-bd69-07a6d7992973
|
||||
userPassword:: e1NTSEF9UWhmaFB3dERydTUydURoWFFObDRMbzVIckI3TkI5Nmo==
|
||||
@@ -0,0 +1,88 @@
|
||||
dn: cn=users,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: users
|
||||
description: Users
|
||||
openCloudUUID: 509a9dcd-bb37-4f4f-a01a-19dca27d9cfa
|
||||
member: uid=alan,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=mary,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=margaret,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=dennis,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=lynn,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=admin,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=chess-lovers,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: chess-lovers
|
||||
description: Chess lovers
|
||||
openCloudUUID: 9d31ec04-dd80-11ef-ac47-a38ba68cc36d
|
||||
member: uid=alan,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=machine-lovers,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: machine-lovers
|
||||
description: Machine Lovers
|
||||
openCloudUUID: d901562a-dd80-11ef-a510-fba1ed43fb21
|
||||
member: uid=alan,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=bible-readers,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: bible-readers
|
||||
description: Bible readers
|
||||
openCloudUUID: 2fc6ba22-dd81-11ef-89e6-e3eff494a998
|
||||
member: uid=mary,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=apollos,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: apollos
|
||||
description: Contributors to the Appollo mission
|
||||
openCloudUUID: 6f9bab36-dd94-11ef-a252-dbbdd20299dd
|
||||
member: uid=margaret,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=unix-lovers,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: unix-lovers
|
||||
description: Unix lovers
|
||||
openCloudUUID: 75bc3882-dd94-11ef-ad60-335f3df6cef3
|
||||
member: uid=dennis,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=basic-haters,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: basic-haters
|
||||
description: Haters of the Basic programming language
|
||||
openCloudUUID: a4eb2c12-dd94-11ef-9ebe-eb96f938d517
|
||||
member: uid=dennis,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=vlsi-lovers,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: vlsi-lovers
|
||||
description: Lovers of VLSI microchip design
|
||||
openCloudUUID: 914ce3de-e899-11ef-9a4b-732fbb2acc42
|
||||
member: uid=lynn,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=programmers,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: programmers
|
||||
description: Computer Programmers
|
||||
openCloudUUID: ce4aa240-dd94-11ef-82b8-4f4828849072
|
||||
member: uid=alan,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=margaret,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=dennis,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=lynn,ou=users,dc=opencloud,dc=eu
|
||||
@@ -7,6 +7,7 @@ directives:
|
||||
- 'https://${COMPANION_DOMAIN|companion.opencloud.test}/'
|
||||
- 'wss://${COMPANION_DOMAIN|companion.opencloud.test}/'
|
||||
- 'https://raw.githubusercontent.com/opencloud-eu/awesome-apps/'
|
||||
- 'https://${KEYCLOAK_DOMAIN|keycloak.opencloud.test}/'
|
||||
default-src:
|
||||
- '''none'''
|
||||
font-src:
|
||||
|
||||
77
deployments/examples/opencloud_full/keycloak.yml
Normal file
77
deployments/examples/opencloud_full/keycloak.yml
Normal file
@@ -0,0 +1,77 @@
|
||||
---
|
||||
services:
|
||||
traefik:
|
||||
networks:
|
||||
opencloud-net:
|
||||
aliases:
|
||||
- ${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}
|
||||
|
||||
opencloud:
|
||||
environment:
|
||||
# Keycloak IDP specific configuration
|
||||
PROXY_AUTOPROVISION_ACCOUNTS: "true"
|
||||
PROXY_ROLE_ASSIGNMENT_DRIVER: "oidc"
|
||||
OC_OIDC_ISSUER: https://${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}/realms/${KEYCLOAK_REALM:-openCloud}
|
||||
PROXY_OIDC_REWRITE_WELLKNOWN: "true"
|
||||
WEB_OIDC_CLIENT_ID: ${OC_OIDC_CLIENT_ID:-web}
|
||||
|
||||
PROXY_USER_OIDC_CLAIM: "preferred_username"
|
||||
PROXY_USER_CS3_CLAIM: "username"
|
||||
OC_EXCLUDE_RUN_SERVICES: "idp"
|
||||
|
||||
# admin and demo accounts must be created in Keycloak
|
||||
OC_ADMIN_USER_ID: ""
|
||||
SETTINGS_SETUP_DEFAULT_ASSIGNMENTS: "false"
|
||||
|
||||
GRAPH_ASSIGN_DEFAULT_USER_ROLE: "false"
|
||||
GRAPH_USERNAME_MATCH: "none"
|
||||
KEYCLOAK_DOMAIN: ${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}
|
||||
|
||||
postgres:
|
||||
image: postgres:alpine
|
||||
networks:
|
||||
opencloud-net:
|
||||
volumes:
|
||||
- keycloak_postgres_data:/var/lib/postgresql/data
|
||||
environment:
|
||||
POSTGRES_DB: keycloak
|
||||
POSTGRES_USER: keycloak
|
||||
POSTGRES_PASSWORD: keycloak
|
||||
logging:
|
||||
driver: ${LOG_DRIVER:-local}
|
||||
restart: always
|
||||
|
||||
keycloak:
|
||||
image: quay.io/keycloak/keycloak:25.0.0
|
||||
networks:
|
||||
opencloud-net:
|
||||
command: ["start", "--proxy=edge", "--spi-connections-http-client-default-disable-trust-manager=${INSECURE:-false}", "--import-realm"]
|
||||
entrypoint: ["/bin/sh", "/opt/keycloak/bin/docker-entrypoint-override.sh"]
|
||||
volumes:
|
||||
- "./config/keycloak/docker-entrypoint-override.sh:/opt/keycloak/bin/docker-entrypoint-override.sh"
|
||||
- "./config/keycloak/opencloud-realm.dist.json:/opt/keycloak/data/import-dist/opencloud-realm.json"
|
||||
environment:
|
||||
OC_DOMAIN: ${OC_DOMAIN:-cloud.opencloud.test}
|
||||
KC_HOSTNAME: ${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}
|
||||
KC_DB: postgres
|
||||
KC_DB_URL: "jdbc:postgresql://postgres:5432/keycloak"
|
||||
KC_DB_USERNAME: keycloak
|
||||
KC_DB_PASSWORD: keycloak
|
||||
KC_FEATURES: impersonation
|
||||
KEYCLOAK_ADMIN: ${KEYCLOAK_ADMIN_USER:-admin}
|
||||
KEYCLOAK_ADMIN_PASSWORD: ${KEYCLOAK_ADMIN_PASSWORD:-admin}
|
||||
labels:
|
||||
- "traefik.enable=true"
|
||||
- "traefik.http.routers.keycloak.entrypoints=https"
|
||||
- "traefik.http.routers.keycloak.rule=Host(`${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}`)"
|
||||
- "traefik.http.routers.keycloak.tls.certresolver=http"
|
||||
- "traefik.http.routers.keycloak.service=keycloak"
|
||||
- "traefik.http.services.keycloak.loadbalancer.server.port=8080"
|
||||
depends_on:
|
||||
- postgres
|
||||
logging:
|
||||
driver: ${LOG_DRIVER:-local}
|
||||
restart: always
|
||||
|
||||
volumes:
|
||||
keycloak_postgres_data:
|
||||
62
deployments/examples/opencloud_full/ldap.yml
Normal file
62
deployments/examples/opencloud_full/ldap.yml
Normal file
@@ -0,0 +1,62 @@
|
||||
---
|
||||
services:
|
||||
traefik:
|
||||
networks:
|
||||
opencloud-net:
|
||||
|
||||
opencloud:
|
||||
environment:
|
||||
# Ldap IDP specific configuration
|
||||
OC_LDAP_URI: ldaps://ldap-server:1636
|
||||
OC_LDAP_INSECURE: "true"
|
||||
OC_LDAP_BIND_DN: "cn=admin,dc=opencloud,dc=eu"
|
||||
OC_LDAP_BIND_PASSWORD: ${LDAP_ADMIN_PASSWORD:-admin}
|
||||
OC_LDAP_GROUP_BASE_DN: "ou=groups,dc=opencloud,dc=eu"
|
||||
OC_LDAP_GROUP_FILTER: "(objectclass=opencloudobject)"
|
||||
OC_LDAP_GROUP_OBJECTCLASS: "groupOfNames"
|
||||
OC_LDAP_USER_BASE_DN: "ou=users,dc=opencloud,dc=eu"
|
||||
OC_LDAP_USER_FILTER: "(objectclass=openclouduser)"
|
||||
OC_LDAP_USER_OBJECTCLASS: "inetOrgPerson"
|
||||
LDAP_LOGIN_ATTRIBUTES: "uid"
|
||||
OC_ADMIN_USER_ID: "f7fc96f6-ceb4-4387-bd69-07a6d7992973"
|
||||
IDP_LDAP_LOGIN_ATTRIBUTE: "uid"
|
||||
IDP_LDAP_UUID_ATTRIBUTE: "openclouduuid"
|
||||
IDP_LDAP_UUID_ATTRIBUTE_TYPE: binary
|
||||
GRAPH_LDAP_SERVER_WRITE_ENABLED: "true" # assuming the external ldap is writable
|
||||
GRAPH_LDAP_REFINT_ENABLED: "true" # osixia has refint enabled.
|
||||
# OC_RUN_SERVICES specifies to start all services except glauth, idm and accounts. These are replaced by external services
|
||||
OC_EXCLUDE_RUN_SERVICES: idm
|
||||
|
||||
ldap-server:
|
||||
image: bitnami/openldap:2.6
|
||||
networks:
|
||||
opencloud-net:
|
||||
entrypoint: ["/bin/sh", "/opt/bitnami/scripts/openldap/docker-entrypoint-override.sh", "/opt/bitnami/scripts/openldap/run.sh" ]
|
||||
environment:
|
||||
BITNAMI_DEBUG: true
|
||||
LDAP_TLS_VERIFY_CLIENT: never
|
||||
LDAP_ENABLE_TLS: "yes"
|
||||
LDAP_TLS_CA_FILE: /opt/bitnami/openldap/share/openldap.crt
|
||||
LDAP_TLS_CERT_FILE: /opt/bitnami/openldap/share/openldap.crt
|
||||
LDAP_TLS_KEY_FILE: /opt/bitnami/openldap/share/openldap.key
|
||||
LDAP_ROOT: "dc=opencloud,dc=eu"
|
||||
LDAP_ADMIN_PASSWORD: ${LDAP_ADMIN_PASSWORD:-admin}
|
||||
ports:
|
||||
- "127.0.0.1:389:1389"
|
||||
- "127.0.0.1:636:1636"
|
||||
volumes:
|
||||
- ./config/ldap/ldif:/ldifs
|
||||
- ../shared/config/ldap/schemas/10_opencloud_schema.ldif:/schemas/10_opencloud_schema.ldif
|
||||
- ./config/ldap/docker-entrypoint-override.sh:/opt/bitnami/scripts/openldap/docker-entrypoint-override.sh
|
||||
- ldap-certs:/opt/bitnami/openldap/share
|
||||
- ldap-data:/bitnami/openldap
|
||||
logging:
|
||||
driver: ${LOG_DRIVER:-local}
|
||||
restart: always
|
||||
|
||||
volumes:
|
||||
ldap-certs:
|
||||
ldap-data:
|
||||
|
||||
networks:
|
||||
opencloud-net:
|
||||
@@ -41,7 +41,11 @@ services:
|
||||
NOTIFICATIONS_SMTP_PORT: "${SMTP_PORT}"
|
||||
NOTIFICATIONS_SMTP_SENDER: "${SMTP_SENDER:-OpenCloud notifications <notifications@${OC_DOMAIN:-cloud.opencloud.test}>}"
|
||||
NOTIFICATIONS_SMTP_USERNAME: "${SMTP_USERNAME}"
|
||||
NOTIFICATIONS_SMTP_PASSWORD: "${SMTP_PASSWORD}"
|
||||
NOTIFICATIONS_SMTP_INSECURE: "${SMTP_INSECURE}"
|
||||
NOTIFICATIONS_SMTP_AUTHENTICATION: "${SMTP_AUTHENTICATION}"
|
||||
NOTIFICATIONS_SMTP_ENCRYPTION: "${SMTP_TRANSPORT_ENCRYPTION:-none}"
|
||||
FRONTEND_ARCHIVER_MAX_SIZE: "10000000000"
|
||||
# make the registry available to the app provider containers
|
||||
MICRO_REGISTRY_ADDRESS: 127.0.0.1:9233
|
||||
NATS_NATS_HOST: 0.0.0.0
|
||||
|
||||
@@ -6,12 +6,10 @@ services:
|
||||
condition: service_completed_successfully
|
||||
|
||||
unzip-init:
|
||||
image: opencloudeu/web-extensions:unzip-1.0.0
|
||||
image: opencloudeu/web-extensions:unzip-1.0.2
|
||||
user: root
|
||||
volumes:
|
||||
- opencloud-apps:/apps
|
||||
entrypoint:
|
||||
- /bin/sh
|
||||
command: ["-c", "cp -R /usr/share/nginx/html/unzip/ /apps"]
|
||||
|
||||
|
||||
|
||||
24
deployments/examples/shared/config/ldap/docker-compose.yml
Normal file
24
deployments/examples/shared/config/ldap/docker-compose.yml
Normal file
@@ -0,0 +1,24 @@
|
||||
---
|
||||
# This file can be used to be added to the opencloud_full example
|
||||
# to browse the LDAP server with a web interface.
|
||||
# This is not a production ready setup.
|
||||
services:
|
||||
ldap-manager:
|
||||
image: phpldapadmin/phpldapadmin:latest
|
||||
networks:
|
||||
opencloud-net:
|
||||
environment:
|
||||
LDAP_HOST: ldap-server
|
||||
LDAP_PORT: 1389
|
||||
LDAP_LOGIN_OBJECTCLASS: "inetOrgPerson"
|
||||
APP_URL: "https://${LDAP_MANAGER_DOMAIN:-ldap.opencloud.test}"
|
||||
labels:
|
||||
- "traefik.enable=true"
|
||||
- "traefik.http.routers.ldap-manager.entrypoints=https"
|
||||
- "traefik.http.routers.ldap-manager.rule=Host(`${LDAP_MANAGER_DOMAIN:-ldap.opencloud.test}`)"
|
||||
- "traefik.http.routers.ldap-manager.tls.certresolver=http"
|
||||
- "traefik.http.routers.ldap-manager.service=ldap-manager"
|
||||
- "traefik.http.services.ldap-manager.loadbalancer.server.port=8080"
|
||||
logging:
|
||||
driver: ${LOG_DRIVER:-local}
|
||||
restart: always
|
||||
@@ -1,17 +0,0 @@
|
||||
---
|
||||
sidebar_position: 1
|
||||
id: intro
|
||||
title: OpenCloud Developer Docs
|
||||
custom_edit_url: https://github.com/opencloud-eu/opencloud/edit/main/docs/intro.md
|
||||
---
|
||||
|
||||
# Welcome
|
||||
|
||||
Welcome to the OpenCloud Developer Documentation.
|
||||
|
||||
Please be patient, we are working on the content.
|
||||
|
||||
If you want to contribute to the dev docs, please visit [OpenCloud on Github](https://github.com/opencloud-eu/).
|
||||
|
||||
Contents will be transferred, during the build process.
|
||||
|
||||
37
go.mod
37
go.mod
@@ -13,7 +13,7 @@ require (
|
||||
github.com/beevik/etree v1.5.0
|
||||
github.com/blevesearch/bleve/v2 v2.4.4
|
||||
github.com/cenkalti/backoff v2.2.1+incompatible
|
||||
github.com/coreos/go-oidc/v3 v3.13.0
|
||||
github.com/coreos/go-oidc/v3 v3.14.1
|
||||
github.com/cs3org/go-cs3apis v0.0.0-20241105092511-3ad35d174fc1
|
||||
github.com/davidbyttow/govips/v2 v2.16.0
|
||||
github.com/dhowden/tag v0.0.0-20240417053706-3d75831295e8
|
||||
@@ -33,7 +33,7 @@ require (
|
||||
github.com/go-micro/plugins/v4/store/nats-js-kv v0.0.0-20240726082623-6831adfdcdc4
|
||||
github.com/go-micro/plugins/v4/wrapper/monitoring/prometheus v1.2.0
|
||||
github.com/go-micro/plugins/v4/wrapper/trace/opentelemetry v1.2.0
|
||||
github.com/go-playground/validator/v10 v10.25.0
|
||||
github.com/go-playground/validator/v10 v10.26.0
|
||||
github.com/gofrs/uuid v4.4.0+incompatible
|
||||
github.com/golang-jwt/jwt/v5 v5.2.2
|
||||
github.com/golang/protobuf v1.5.4
|
||||
@@ -56,14 +56,14 @@ require (
|
||||
github.com/mna/pigeon v1.3.0
|
||||
github.com/mohae/deepcopy v0.0.0-20170929034955-c48cc78d4826
|
||||
github.com/nats-io/nats-server/v2 v2.11.0
|
||||
github.com/nats-io/nats.go v1.39.1
|
||||
github.com/nats-io/nats.go v1.41.0
|
||||
github.com/oklog/run v1.1.0
|
||||
github.com/olekukonko/tablewriter v0.0.5
|
||||
github.com/onsi/ginkgo v1.16.5
|
||||
github.com/onsi/ginkgo/v2 v2.23.3
|
||||
github.com/onsi/gomega v1.36.3
|
||||
github.com/open-policy-agent/opa v1.2.0
|
||||
github.com/opencloud-eu/reva/v2 v2.29.1
|
||||
github.com/onsi/ginkgo/v2 v2.23.4
|
||||
github.com/onsi/gomega v1.37.0
|
||||
github.com/open-policy-agent/opa v1.3.0
|
||||
github.com/opencloud-eu/reva/v2 v2.31.0
|
||||
github.com/orcaman/concurrent-map v1.0.0
|
||||
github.com/owncloud/libre-graph-api-go v1.0.5-0.20240829135935-80dc00d6f5ea
|
||||
github.com/pkg/errors v0.9.1
|
||||
@@ -82,9 +82,9 @@ require (
|
||||
github.com/test-go/testify v1.1.4
|
||||
github.com/thejerf/suture/v4 v4.0.6
|
||||
github.com/tidwall/gjson v1.18.0
|
||||
github.com/tus/tusd/v2 v2.7.1
|
||||
github.com/tus/tusd/v2 v2.8.0
|
||||
github.com/unrolled/secure v1.16.0
|
||||
github.com/urfave/cli/v2 v2.27.5
|
||||
github.com/urfave/cli/v2 v2.27.6
|
||||
github.com/xhit/go-simple-mail/v2 v2.16.0
|
||||
go-micro.dev/v4 v4.11.0
|
||||
go.etcd.io/bbolt v1.4.0
|
||||
@@ -99,14 +99,14 @@ require (
|
||||
golang.org/x/crypto v0.36.0
|
||||
golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac
|
||||
golang.org/x/image v0.25.0
|
||||
golang.org/x/net v0.37.0
|
||||
golang.org/x/net v0.38.0
|
||||
golang.org/x/oauth2 v0.28.0
|
||||
golang.org/x/sync v0.12.0
|
||||
golang.org/x/term v0.30.0
|
||||
golang.org/x/text v0.23.0
|
||||
google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb
|
||||
google.golang.org/grpc v1.71.0
|
||||
google.golang.org/protobuf v1.36.5
|
||||
google.golang.org/grpc v1.71.1
|
||||
google.golang.org/protobuf v1.36.6
|
||||
gopkg.in/yaml.v2 v2.4.0
|
||||
gotest.tools/v3 v3.5.2
|
||||
stash.kopano.io/kgol/rndm v1.1.2
|
||||
@@ -216,7 +216,7 @@ require (
|
||||
github.com/gomodule/redigo v1.9.2 // indirect
|
||||
github.com/google/go-querystring v1.1.0 // indirect
|
||||
github.com/google/go-tpm v0.9.3 // indirect
|
||||
github.com/google/pprof v0.0.0-20241210010833-40e02aabc2ad // indirect
|
||||
github.com/google/pprof v0.0.0-20250403155104-27863c87afa6 // indirect
|
||||
github.com/google/renameio/v2 v2.0.0 // indirect
|
||||
github.com/gookit/color v1.5.4 // indirect
|
||||
github.com/gookit/goutil v0.6.15 // indirect
|
||||
@@ -237,7 +237,7 @@ require (
|
||||
github.com/juliangruber/go-intersect v1.1.0 // indirect
|
||||
github.com/kevinburke/ssh_config v1.2.0 // indirect
|
||||
github.com/klauspost/compress v1.18.0 // indirect
|
||||
github.com/klauspost/cpuid/v2 v2.2.9 // indirect
|
||||
github.com/klauspost/cpuid/v2 v2.2.10 // indirect
|
||||
github.com/leodido/go-urn v1.4.0 // indirect
|
||||
github.com/libregraph/oidc-go v1.1.0 // indirect
|
||||
github.com/longsleep/go-metrics v1.0.0 // indirect
|
||||
@@ -246,7 +246,7 @@ require (
|
||||
github.com/mattn/go-colorable v0.1.14 // indirect
|
||||
github.com/mattn/go-isatty v0.0.20 // indirect
|
||||
github.com/mattn/go-runewidth v0.0.16 // indirect
|
||||
github.com/mattn/go-sqlite3 v1.14.24 // indirect
|
||||
github.com/mattn/go-sqlite3 v1.14.27 // indirect
|
||||
github.com/maxymania/go-system v0.0.0-20170110133659-647cc364bf0b // indirect
|
||||
github.com/mendsley/gojwk v0.0.0-20141217222730-4d5ec6e58103 // indirect
|
||||
github.com/miekg/dns v1.1.57 // indirect
|
||||
@@ -254,7 +254,7 @@ require (
|
||||
github.com/minio/crc64nvme v1.0.1 // indirect
|
||||
github.com/minio/highwayhash v1.0.3 // indirect
|
||||
github.com/minio/md5-simd v1.1.2 // indirect
|
||||
github.com/minio/minio-go/v7 v7.0.88 // indirect
|
||||
github.com/minio/minio-go/v7 v7.0.89 // indirect
|
||||
github.com/mitchellh/copystructure v1.2.0 // indirect
|
||||
github.com/mitchellh/reflectwalk v1.0.2 // indirect
|
||||
github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect
|
||||
@@ -318,14 +318,15 @@ require (
|
||||
go.opentelemetry.io/otel/metric v1.35.0 // indirect
|
||||
go.opentelemetry.io/proto/otlp v1.5.0 // indirect
|
||||
go.uber.org/atomic v1.11.0 // indirect
|
||||
go.uber.org/automaxprocs v1.6.0 // indirect
|
||||
go.uber.org/multierr v1.11.0 // indirect
|
||||
go.uber.org/zap v1.23.0 // indirect
|
||||
golang.org/x/mod v0.24.0 // indirect
|
||||
golang.org/x/sys v0.31.0 // indirect
|
||||
golang.org/x/sys v0.32.0 // indirect
|
||||
golang.org/x/time v0.11.0 // indirect
|
||||
golang.org/x/tools v0.31.0 // indirect
|
||||
golang.org/x/xerrors v0.0.0-20220907171357-04be3eba64a2 // indirect
|
||||
google.golang.org/genproto v0.0.0-20241118233622-e639e219e697 // indirect
|
||||
google.golang.org/genproto v0.0.0-20250303144028-a0af3efb3deb // indirect
|
||||
google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb // indirect
|
||||
gopkg.in/cenkalti/backoff.v1 v1.1.0 // indirect
|
||||
gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 // indirect
|
||||
|
||||
86
go.sum
86
go.sum
@@ -222,8 +222,8 @@ github.com/cloudflare/cloudflare-go v0.14.0/go.mod h1:EnwdgGMaFOruiPZRFSgn+TsQ3h
|
||||
github.com/cncf/udpa/go v0.0.0-20191209042840-269d4d468f6f/go.mod h1:M8M6+tZqaGXZJjfX53e64911xZQV5JYwmTeXPW+k8Sc=
|
||||
github.com/coreos/bbolt v1.3.2/go.mod h1:iRUV2dpdMOn7Bo10OQBFzIJO9kkE559Wcmn+qkEiiKk=
|
||||
github.com/coreos/etcd v3.3.13+incompatible/go.mod h1:uF7uidLiAD3TWHmW31ZFd/JWoc32PjwdhPthX9715RE=
|
||||
github.com/coreos/go-oidc/v3 v3.13.0 h1:M66zd0pcc5VxvBNM4pB331Wrsanby+QomQYjN8HamW8=
|
||||
github.com/coreos/go-oidc/v3 v3.13.0/go.mod h1:HaZ3szPaZ0e4r6ebqvsLWlk2Tn+aejfmrfah6hnSYEU=
|
||||
github.com/coreos/go-oidc/v3 v3.14.1 h1:9ePWwfdwC4QKRlCXsJGou56adA/owXczOzwKdOumLqk=
|
||||
github.com/coreos/go-oidc/v3 v3.14.1/go.mod h1:HaZ3szPaZ0e4r6ebqvsLWlk2Tn+aejfmrfah6hnSYEU=
|
||||
github.com/coreos/go-semver v0.3.0 h1:wkHLiw0WNATZnSG7epLsujiMCgPAc9xhjJ4tgnAxmfM=
|
||||
github.com/coreos/go-semver v0.3.0/go.mod h1:nnelYz7RCh+5ahJtPPxZlU+153eP4D4r3EedlOD2RNk=
|
||||
github.com/coreos/go-systemd v0.0.0-20190321100706-95778dfbb74e/go.mod h1:F5haX7vjVVG0kc13fIWeqUViNPyEJxv/OmvnBo0Yme4=
|
||||
@@ -258,8 +258,8 @@ github.com/deckarep/golang-set v1.8.0/go.mod h1:5nI87KwE7wgsBU1F4GKAw2Qod7p5kyS3
|
||||
github.com/deepmap/oapi-codegen v1.3.11/go.mod h1:suMvK7+rKlx3+tpa8ByptmvoXbAV70wERKTOGH3hLp0=
|
||||
github.com/desertbit/timer v0.0.0-20180107155436-c41aec40b27f h1:U5y3Y5UE0w7amNe7Z5G/twsBW0KEalRQXZzf8ufSh9I=
|
||||
github.com/desertbit/timer v0.0.0-20180107155436-c41aec40b27f/go.mod h1:xH/i4TFMt8koVQZ6WFms69WAsDWr2XsYL3Hkl7jkoLE=
|
||||
github.com/dgraph-io/badger/v4 v4.5.1 h1:7DCIXrQjo1LKmM96YD+hLVJ2EEsyyoWxJfpdd56HLps=
|
||||
github.com/dgraph-io/badger/v4 v4.5.1/go.mod h1:qn3Be0j3TfV4kPbVoK0arXCD1/nr1ftth6sbL5jxdoA=
|
||||
github.com/dgraph-io/badger/v4 v4.6.0 h1:acOwfOOZ4p1dPRnYzvkVm7rUk2Y21TgPVepCy5dJdFQ=
|
||||
github.com/dgraph-io/badger/v4 v4.6.0/go.mod h1:KSJ5VTuZNC3Sd+YhvVjk2nYua9UZnnTr/SkXvdtiPgI=
|
||||
github.com/dgraph-io/ristretto v0.2.0 h1:XAfl+7cmoUDWW/2Lx8TGZQjjxIQ2Ley9DSf52dru4WE=
|
||||
github.com/dgraph-io/ristretto v0.2.0/go.mod h1:8uBHCU/PBV4Ag0CJrP47b9Ofby5dqWNh4FicAdoqFNU=
|
||||
github.com/dgraph-io/ristretto/v2 v2.1.0 h1:59LjpOJLNDULHh8MC4UaegN52lC4JnO2dITsie/Pa8I=
|
||||
@@ -411,8 +411,8 @@ github.com/go-playground/locales v0.14.1 h1:EWaQ/wswjilfKLTECiXz7Rh+3BjFhfDFKv/o
|
||||
github.com/go-playground/locales v0.14.1/go.mod h1:hxrqLVvrK65+Rwrd5Fc6F2O76J/NuW9t0sjnWqG1slY=
|
||||
github.com/go-playground/universal-translator v0.18.1 h1:Bcnm0ZwsGyWbCzImXv+pAJnYK9S473LQFuzCbDbfSFY=
|
||||
github.com/go-playground/universal-translator v0.18.1/go.mod h1:xekY+UJKNuX9WP91TpwSH2VMlDf28Uj24BCp08ZFTUY=
|
||||
github.com/go-playground/validator/v10 v10.25.0 h1:5Dh7cjvzR7BRZadnsVOzPhWsrwUr0nmsZJxEAnFLNO8=
|
||||
github.com/go-playground/validator/v10 v10.25.0/go.mod h1:GGzBIJMuE98Ic/kJsBXbz1x/7cByt++cQ+YOuDM5wus=
|
||||
github.com/go-playground/validator/v10 v10.26.0 h1:SP05Nqhjcvz81uJaRfEV0YBSSSGMc/iMaVtFbr3Sw2k=
|
||||
github.com/go-playground/validator/v10 v10.26.0/go.mod h1:I5QpIEbmr8On7W0TktmJAumgzX4CA1XNl4ZmDuVHKKo=
|
||||
github.com/go-redis/redis/v8 v8.11.5 h1:AcZZR7igkdvfVmQTPnu9WE37LRrO/YrBH5zWyjDC0oI=
|
||||
github.com/go-redis/redis/v8 v8.11.5/go.mod h1:gREzHqY1hg6oD9ngVRbLStwAWKhA0FEgq8Jd4h5lpwo=
|
||||
github.com/go-resty/resty/v2 v2.1.1-0.20191201195748-d7b97669fe48/go.mod h1:dZGr0i9PLlaaTD4H/hoZIDjQ+r6xq8mgbRzHZf7f2J8=
|
||||
@@ -504,8 +504,8 @@ github.com/gomodule/redigo v1.9.2 h1:HrutZBLhSIU8abiSfW8pj8mPhOyMYjZT/wcA4/L9L9s
|
||||
github.com/gomodule/redigo v1.9.2/go.mod h1:KsU3hiK/Ay8U42qpaJk+kuNa3C+spxapWpM+ywhcgtw=
|
||||
github.com/google/btree v0.0.0-20180813153112-4030bb1f1f0c/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ=
|
||||
github.com/google/btree v1.0.0/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ=
|
||||
github.com/google/flatbuffers v24.12.23+incompatible h1:ubBKR94NR4pXUCY/MUsRVzd9umNW7ht7EG9hHfS9FX8=
|
||||
github.com/google/flatbuffers v24.12.23+incompatible/go.mod h1:1AeVuKshWv4vARoZatz6mlQ0JxURH0Kv5+zNeJKJCa8=
|
||||
github.com/google/flatbuffers v25.2.10+incompatible h1:F3vclr7C3HpB1k9mxCGRMXq6FdUalZ6H/pNX4FP1v0Q=
|
||||
github.com/google/flatbuffers v25.2.10+incompatible/go.mod h1:1AeVuKshWv4vARoZatz6mlQ0JxURH0Kv5+zNeJKJCa8=
|
||||
github.com/google/go-cmp v0.2.0/go.mod h1:oXzfMopK8JAjlY9xF4vHSVASa0yLyX7SntLO5aqRK0M=
|
||||
github.com/google/go-cmp v0.3.0/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU=
|
||||
github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU=
|
||||
@@ -540,8 +540,8 @@ github.com/google/pprof v0.0.0-20200212024743-f11f1df84d12/go.mod h1:ZgVRPoUq/hf
|
||||
github.com/google/pprof v0.0.0-20200229191704-1ebb73c60ed3/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
|
||||
github.com/google/pprof v0.0.0-20200430221834-fc25d7d30c6d/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
|
||||
github.com/google/pprof v0.0.0-20200708004538-1a94d8640e99/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
|
||||
github.com/google/pprof v0.0.0-20241210010833-40e02aabc2ad h1:a6HEuzUHeKH6hwfN/ZoQgRgVIWFJljSWa/zetS2WTvg=
|
||||
github.com/google/pprof v0.0.0-20241210010833-40e02aabc2ad/go.mod h1:vavhavw2zAxS5dIdcRluK6cSGGPlZynqzFM8NdvU144=
|
||||
github.com/google/pprof v0.0.0-20250403155104-27863c87afa6 h1:BHT72Gu3keYf3ZEu2J0b1vyeLSOYI8bm5wbJM/8yDe8=
|
||||
github.com/google/pprof v0.0.0-20250403155104-27863c87afa6/go.mod h1:boTsfXsheKC2y+lKOCMpSfarhxDeIzfZG1jqGcPl3cA=
|
||||
github.com/google/renameio v0.1.0/go.mod h1:KWCgfxg9yswjAJkECMjeO8J8rahYeXnNhOm40UhjYkI=
|
||||
github.com/google/renameio/v2 v2.0.0 h1:UifI23ZTGY8Tt29JbYFiuyIU3eX+RNFtUwefq9qAhxg=
|
||||
github.com/google/renameio/v2 v2.0.0/go.mod h1:BtmJXm5YlszgC+TD4HOEEUFgkJP3nLxehU6hfe7jRt4=
|
||||
@@ -689,8 +689,8 @@ github.com/klauspost/compress v1.15.9/go.mod h1:PhcZ0MbTNciWF3rruxRgKxI5NkcHHrHU
|
||||
github.com/klauspost/compress v1.18.0 h1:c/Cqfb0r+Yi+JtIEq73FWXVkRonBlf0CRNYc8Zttxdo=
|
||||
github.com/klauspost/compress v1.18.0/go.mod h1:2Pp+KzxcywXVXMr50+X0Q/Lsb43OQHYWRCY2AiWywWQ=
|
||||
github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
|
||||
github.com/klauspost/cpuid/v2 v2.2.9 h1:66ze0taIn2H33fBvCkXuv9BmCwDfafmiIVpKV9kKGuY=
|
||||
github.com/klauspost/cpuid/v2 v2.2.9/go.mod h1:rqkxqrZ1EhYM9G+hXH7YdowN5R5RGN6NK4QwQ3WMXF8=
|
||||
github.com/klauspost/cpuid/v2 v2.2.10 h1:tBs3QSyvjDyFTq3uoc/9xFpCuOsJQFNPiAhYdw2skhE=
|
||||
github.com/klauspost/cpuid/v2 v2.2.10/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0=
|
||||
github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202 h1:A1xJ2NKgiYFiaHiLl9B5yw/gUBACSs9crDykTS3GuQI=
|
||||
github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202/go.mod h1:bHA7t77X/QFExdeAnDzK6vKM34kEZAcE1OX4MfiwjkE=
|
||||
github.com/kobergj/plugins/v4/store/nats-js-kv v0.0.0-20240807130109-f62bb67e8c90 h1:pfI8Z5yavO6fU6vDGlWhZ4BgDlvj8c6xB7J57HfTPwA=
|
||||
@@ -768,8 +768,8 @@ github.com/mattn/go-runewidth v0.0.6/go.mod h1:H031xJmbD/WCDINGzjvQ9THkh0rPKHF+m
|
||||
github.com/mattn/go-runewidth v0.0.9/go.mod h1:H031xJmbD/WCDINGzjvQ9THkh0rPKHF+m2gUSrubnMI=
|
||||
github.com/mattn/go-runewidth v0.0.16 h1:E5ScNMtiwvlvB5paMFdw9p4kSQzbXFikJ5SQO6TULQc=
|
||||
github.com/mattn/go-runewidth v0.0.16/go.mod h1:Jdepj2loyihRzMpdS35Xk/zdY8IAYHsh153qUoGf23w=
|
||||
github.com/mattn/go-sqlite3 v1.14.24 h1:tpSp2G2KyMnnQu99ngJ47EIkWVmliIizyZBfPrBWDRM=
|
||||
github.com/mattn/go-sqlite3 v1.14.24/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
|
||||
github.com/mattn/go-sqlite3 v1.14.27 h1:drZCnuvf37yPfs95E5jd9s3XhdVWLal+6BOK6qrv6IU=
|
||||
github.com/mattn/go-sqlite3 v1.14.27/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
|
||||
github.com/mattn/go-tty v0.0.0-20180219170247-931426f7535a/go.mod h1:XPvLUNfbS4fJH25nqRHfWLMa1ONC8Amw+mIA639KxkE=
|
||||
github.com/mattn/go-tty v0.0.3/go.mod h1:ihxohKRERHTVzN+aSVRwACLCeqIoZAWpoICkkvrWyR0=
|
||||
github.com/matttproud/golang_protobuf_extensions v1.0.1/go.mod h1:D8He9yQNgCq6Z5Ld7szi9bcBfOoFv/3dc6xSMkL2PC0=
|
||||
@@ -789,8 +789,8 @@ github.com/minio/highwayhash v1.0.3 h1:kbnuUMoHYyVl7szWjSxJnxw11k2U709jqFPPmIUyD
|
||||
github.com/minio/highwayhash v1.0.3/go.mod h1:GGYsuwP/fPD6Y9hMiXuapVvlIUEhFhMTh0rxU3ik1LQ=
|
||||
github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34=
|
||||
github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM=
|
||||
github.com/minio/minio-go/v7 v7.0.88 h1:v8MoIJjwYxOkehp+eiLIuvXk87P2raUtoU5klrAAshs=
|
||||
github.com/minio/minio-go/v7 v7.0.88/go.mod h1:33+O8h0tO7pCeCWwBVa07RhVVfB/3vS4kEX7rwYKmIg=
|
||||
github.com/minio/minio-go/v7 v7.0.89 h1:hx4xV5wwTUfyv8LarhJAwNecnXpoTsj9v3f3q/ZkiJU=
|
||||
github.com/minio/minio-go/v7 v7.0.89/go.mod h1:2rFnGAp02p7Dddo1Fq4S2wYOfpF0MUTSeLTRC90I204=
|
||||
github.com/mitchellh/cli v1.0.0/go.mod h1:hNIlj7HEI86fIcpObd7a0FcrxTWetlwJDGcceTlRvqc=
|
||||
github.com/mitchellh/copystructure v1.2.0 h1:vpKXTN4ewci03Vljg/q9QvCGUDttBOGBIa15WveJJGw=
|
||||
github.com/mitchellh/copystructure v1.2.0/go.mod h1:qLl+cE2AmVv+CoeAwDPye/v+N2HKCj9FbZEVFJRxO9s=
|
||||
@@ -829,8 +829,8 @@ github.com/nats-io/jwt/v2 v2.7.3 h1:6bNPK+FXgBeAqdj4cYQ0F8ViHRbi7woQLq4W29nUAzE=
|
||||
github.com/nats-io/jwt/v2 v2.7.3/go.mod h1:GvkcbHhKquj3pkioy5put1wvPxs78UlZ7D/pY+BgZk4=
|
||||
github.com/nats-io/nats-server/v2 v2.11.0 h1:fdwAT1d6DZW/4LUz5rkvQUe5leGEwjjOQYntzVRKvjE=
|
||||
github.com/nats-io/nats-server/v2 v2.11.0/go.mod h1:leXySghbdtXSUmWem8K9McnJ6xbJOb0t9+NQ5HTRZjI=
|
||||
github.com/nats-io/nats.go v1.39.1 h1:oTkfKBmz7W047vRxV762M67ZdXeOtUgvbBaNoQ+3PPk=
|
||||
github.com/nats-io/nats.go v1.39.1/go.mod h1:MgRb8oOdigA6cYpEPhXJuRVH6UE/V4jblJ2jQ27IXYM=
|
||||
github.com/nats-io/nats.go v1.41.0 h1:PzxEva7fflkd+n87OtQTXqCTyLfIIMFJBpyccHLE2Ko=
|
||||
github.com/nats-io/nats.go v1.41.0/go.mod h1:wV73x0FSI/orHPSYoyMeJB+KajMDoWyXmFaRrrYaaTo=
|
||||
github.com/nats-io/nkeys v0.4.10 h1:glmRrpCmYLHByYcePvnTBEAwawwapjCPMjy2huw20wc=
|
||||
github.com/nats-io/nkeys v0.4.10/go.mod h1:OjRrnIKnWBFl+s4YK5ChQfvHP2fxqZexrKJoVVyWB3U=
|
||||
github.com/nats-io/nuid v1.0.1 h1:5iA8DT8V7q8WK2EScv2padNa/rTESc1KdnPw4TC2paw=
|
||||
@@ -856,17 +856,17 @@ github.com/onsi/ginkgo v1.7.0/go.mod h1:lLunBs/Ym6LB5Z9jYTR76FiuTmxDTDusOGeTQH+W
|
||||
github.com/onsi/ginkgo v1.12.1/go.mod h1:zj2OWP4+oCPe1qIXoGWkgMRwljMUYCdkwsT2108oapk=
|
||||
github.com/onsi/ginkgo v1.16.5 h1:8xi0RTUf59SOSfEtZMvwTvXYMzG4gV23XVHOZiXNtnE=
|
||||
github.com/onsi/ginkgo v1.16.5/go.mod h1:+E8gABHa3K6zRBolWtd+ROzc/U5bkGt0FwiG042wbpU=
|
||||
github.com/onsi/ginkgo/v2 v2.23.3 h1:edHxnszytJ4lD9D5Jjc4tiDkPBZ3siDeJJkUZJJVkp0=
|
||||
github.com/onsi/ginkgo/v2 v2.23.3/go.mod h1:zXTP6xIp3U8aVuXN8ENK9IXRaTjFnpVB9mGmaSRvxnM=
|
||||
github.com/onsi/ginkgo/v2 v2.23.4 h1:ktYTpKJAVZnDT4VjxSbiBenUjmlL/5QkBEocaWXiQus=
|
||||
github.com/onsi/ginkgo/v2 v2.23.4/go.mod h1:Bt66ApGPBFzHyR+JO10Zbt0Gsp4uWxu5mIOTusL46e8=
|
||||
github.com/onsi/gomega v1.4.3/go.mod h1:ex+gbHU/CVuBBDIJjb2X0qEXbFg53c61hWP/1CpauHY=
|
||||
github.com/onsi/gomega v1.7.1/go.mod h1:XdKZgCCFLUoM/7CFJVPcG8C1xQ1AJ0vpAezJrB7JYyY=
|
||||
github.com/onsi/gomega v1.10.1/go.mod h1:iN09h71vgCQne3DLsj+A5owkum+a2tYe+TOCB1ybHNo=
|
||||
github.com/onsi/gomega v1.36.3 h1:hID7cr8t3Wp26+cYnfcjR6HpJ00fdogN6dqZ1t6IylU=
|
||||
github.com/onsi/gomega v1.36.3/go.mod h1:8D9+Txp43QWKhM24yyOBEdpkzN8FvJyAwecBgsU4KU0=
|
||||
github.com/open-policy-agent/opa v1.2.0 h1:88NDVCM0of1eO6Z4AFeL3utTEtMuwloFmWWU7dRV1z0=
|
||||
github.com/open-policy-agent/opa v1.2.0/go.mod h1:30euUmOvuBoebRCcJ7DMF42bRBOPznvt0ACUMYDUGVY=
|
||||
github.com/opencloud-eu/reva/v2 v2.29.1 h1:SgB2zn8d/3UWwFiJ0pUs85aDKJJ36JoKnyRM+iW+VoI=
|
||||
github.com/opencloud-eu/reva/v2 v2.29.1/go.mod h1:+nkCU7w6E6cyNSsKRYj1rb0cCI7QswEQ7KOPljctebM=
|
||||
github.com/onsi/gomega v1.37.0 h1:CdEG8g0S133B4OswTDC/5XPSzE1OeP29QOioj2PID2Y=
|
||||
github.com/onsi/gomega v1.37.0/go.mod h1:8D9+Txp43QWKhM24yyOBEdpkzN8FvJyAwecBgsU4KU0=
|
||||
github.com/open-policy-agent/opa v1.3.0 h1:zVvQvQg+9+FuSRBt4LgKNzJwsWl/c85kD5jPozJTydY=
|
||||
github.com/open-policy-agent/opa v1.3.0/go.mod h1:t9iPNhaplD2qpiBqeudzJtEX3fKHK8zdA29oFvofAHo=
|
||||
github.com/opencloud-eu/reva/v2 v2.31.0 h1:UVgeb0hSPoaDdqcKSJ7XZAhXCtHaVK9qm/JtFtJM/7U=
|
||||
github.com/opencloud-eu/reva/v2 v2.31.0/go.mod h1:8MT1a/WJASZZhlSMC0oeE3ECQdjqFw3BUiiAIZ/JR8I=
|
||||
github.com/opentracing/opentracing-go v1.1.0/go.mod h1:UkNAQd3GIcIGf0SeVgPpRdFStlNbqXla1AfSYxPUl2o=
|
||||
github.com/opentracing/opentracing-go v1.2.0 h1:uEJPy/1a5RIPAJ0Ov+OIO8OxWu77jEv+1B0VhjKrZUs=
|
||||
github.com/opentracing/opentracing-go v1.2.0/go.mod h1:GxEUsuufX4nBwe+T+Wl9TAgYrxe9dPLANfrWvHYVTgc=
|
||||
@@ -911,6 +911,8 @@ github.com/posener/complete v1.1.1/go.mod h1:em0nMJCgc9GFtwrmVmEMR/ZL6WyhyjMBndr
|
||||
github.com/pquerna/cachecontrol v0.2.0 h1:vBXSNuE5MYP9IJ5kjsdo8uq+w41jSPgvba2DEnkRx9k=
|
||||
github.com/pquerna/cachecontrol v0.2.0/go.mod h1:NrUG3Z7Rdu85UNR3vm7SOsl1nFIeSiQnrHV5K9mBcUI=
|
||||
github.com/pquerna/otp v1.3.0/go.mod h1:dkJfzwRKNiegxyNb54X/3fLwhCynbMspSyWKnvi1AEg=
|
||||
github.com/prashantv/gostub v1.1.0 h1:BTyx3RfQjRHnUWaGF9oQos79AlQ5k8WNktv7VGvVH4g=
|
||||
github.com/prashantv/gostub v1.1.0/go.mod h1:A5zLQHz7ieHGG7is6LLXLz7I8+3LZzsrV0P1IAHhP5U=
|
||||
github.com/prometheus/alertmanager v0.28.1 h1:BK5pCoAtaKg01BYRUJhEDV1tqJMEtYBGzPw8QdvnnvA=
|
||||
github.com/prometheus/alertmanager v0.28.1/go.mod h1:0StpPUDDHi1VXeM7p2yYfeZgLVi/PPlt39vo9LQUHxM=
|
||||
github.com/prometheus/client_golang v0.8.0/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXPKyh/dDVn+NZz0KFw=
|
||||
@@ -1098,13 +1100,13 @@ github.com/toorop/go-dkim v0.0.0-20201103131630-e1cd1a0a5208/go.mod h1:BzWtXXrXz
|
||||
github.com/transip/gotransip/v6 v6.2.0/go.mod h1:pQZ36hWWRahCUXkFWlx9Hs711gLd8J4qdgLdRzmtY+g=
|
||||
github.com/trustelem/zxcvbn v1.0.1 h1:mp4JFtzdDYGj9WYSD3KQSkwwUumWNFzXaAjckaTYpsc=
|
||||
github.com/trustelem/zxcvbn v1.0.1/go.mod h1:zonUyKeh7sw6psPf/e3DtRqkRyZvAbOfjNz/aO7YQ5s=
|
||||
github.com/tus/tusd/v2 v2.7.1 h1:TGJjhv9RYXDmsTz8ug/qSd9vQpmD0Ik0G0IPo80Qmc0=
|
||||
github.com/tus/tusd/v2 v2.7.1/go.mod h1:PLdIMQ/ge+5ADgGKcL3FgTaPs+7wB0JIiI5HQXAiJE8=
|
||||
github.com/tus/tusd/v2 v2.8.0 h1:X2jGxQ05jAW4inDd2ogmOKqwnb4c/D0lw2yhgHayWyU=
|
||||
github.com/tus/tusd/v2 v2.8.0/go.mod h1:3/zEOVQQIwmJhvNam8phV4x/UQt68ZmZiTzeuJUNhVo=
|
||||
github.com/uber-go/atomic v1.3.2/go.mod h1:/Ct5t2lcmbJ4OSe/waGBoaVvVqtO0bmtfVNex1PFV8g=
|
||||
github.com/urfave/cli v1.22.4/go.mod h1:Gos4lmkARVdJ6EkW0WaNv/tZAAMe9V7XWyB60NtXRu0=
|
||||
github.com/urfave/cli/v2 v2.3.0/go.mod h1:LJmUH05zAU44vOAcrfzZQKsZbVcdbOG8rtL3/XcUArI=
|
||||
github.com/urfave/cli/v2 v2.27.5 h1:WoHEJLdsXr6dDWoJgMq/CboDmyY/8HMMH1fTECbih+w=
|
||||
github.com/urfave/cli/v2 v2.27.5/go.mod h1:3Sevf16NykTbInEnD0yKkjDAeZDS0A6bzhBH5hrMvTQ=
|
||||
github.com/urfave/cli/v2 v2.27.6 h1:VdRdS98FNhKZ8/Az8B7MTyGQmpIr36O1EHybx/LaZ4g=
|
||||
github.com/urfave/cli/v2 v2.27.6/go.mod h1:3Sevf16NykTbInEnD0yKkjDAeZDS0A6bzhBH5hrMvTQ=
|
||||
github.com/valyala/bytebufferpool v1.0.0/go.mod h1:6bBcMArwyJ5K/AmCkWv1jt77kVWyCJ6HpOuEn7z0Csc=
|
||||
github.com/valyala/fasttemplate v1.0.1/go.mod h1:UQGH1tvbgY+Nz5t2n7tXsz52dQxojPUpymEIMZ47gx8=
|
||||
github.com/valyala/fasttemplate v1.1.0/go.mod h1:UQGH1tvbgY+Nz5t2n7tXsz52dQxojPUpymEIMZ47gx8=
|
||||
@@ -1177,6 +1179,8 @@ go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.35.0 h1:1fTNlAIJZGWLP5FVu0f
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.35.0/go.mod h1:zjPK58DtkqQFn+YUMbx0M2XV3QgKU0gS9LeGohREyK4=
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.35.0 h1:m639+BofXTvcY1q8CGs4ItwQarYtJPOWmVobfM1HpVI=
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.35.0/go.mod h1:LjReUci/F4BUyv+y4dwnq3h/26iNOeC3wAIqgvTIZVo=
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp v1.35.0 h1:xJ2qHD0C1BeYVTLLR9sX12+Qb95kfeD/byKj6Ky1pXg=
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp v1.35.0/go.mod h1:u5BF1xyjstDowA1R5QAO9JHzqK+ublenEW/dyqTjBVk=
|
||||
go.opentelemetry.io/otel/metric v1.35.0 h1:0znxYu2SNyuMSQT4Y9WDWej0VpcsxkuklLa4/siN90M=
|
||||
go.opentelemetry.io/otel/metric v1.35.0/go.mod h1:nKVFgxBZ2fReX6IlyW28MgZojkoAkJGaE8CpgeAU3oE=
|
||||
go.opentelemetry.io/otel/sdk v1.35.0 h1:iPctf8iprVySXSKJffSS79eOjl9pvxV9ZqOWT0QejKY=
|
||||
@@ -1192,6 +1196,8 @@ go.uber.org/atomic v1.4.0/go.mod h1:gD2HeocX3+yG+ygLZcrzQJaqmWj9AIm7n08wl/qW/PE=
|
||||
go.uber.org/atomic v1.7.0/go.mod h1:fEN4uk6kAWBTFdckzkM89CLk9XfWZrxpCo0nPH17wJc=
|
||||
go.uber.org/atomic v1.11.0 h1:ZvwS0R+56ePWxUNi+Atn9dWONBPp/AUETXlHW0DxSjE=
|
||||
go.uber.org/atomic v1.11.0/go.mod h1:LUxbIzbOniOlMKjJjyPfpl4v+PKK2cNJn91OQbhoJI0=
|
||||
go.uber.org/automaxprocs v1.6.0 h1:O3y2/QNTOdbF+e/dpXNNW7Rx2hZ4sTIPyybbxyNqTUs=
|
||||
go.uber.org/automaxprocs v1.6.0/go.mod h1:ifeIMSnPZuznNm6jmdzmU3/bfk01Fe2fotchwEFJ8r8=
|
||||
go.uber.org/goleak v1.1.10/go.mod h1:8a7PlsEVH3e/a/GLqe5IIrQx6GzcnRmZEufDUTk4A7A=
|
||||
go.uber.org/goleak v1.3.0 h1:2K3zAYmnTNqV73imy9J1T3WC+gmCePx2hEGkimedGto=
|
||||
go.uber.org/goleak v1.3.0/go.mod h1:CoHD4mav9JJNrW/WLlf7HGZPjdw8EucARQHekz1X6bE=
|
||||
@@ -1328,8 +1334,8 @@ golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
|
||||
golang.org/x/net v0.23.0/go.mod h1:JKghWKKOSdJwpW2GEx0Ja7fmaKnMsbu+MWVZTokSYmg=
|
||||
golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
|
||||
golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
|
||||
golang.org/x/net v0.37.0 h1:1zLorHbz+LYj7MQlSf1+2tPIIgibq2eL5xkrGk6f+2c=
|
||||
golang.org/x/net v0.37.0/go.mod h1:ivrbrMbzFq5J41QOQh0siUuly180yBYtLp+CKbEaFx8=
|
||||
golang.org/x/net v0.38.0 h1:vRMAPTMaeGqVhG5QyLJHqNDwecKTomGeqbnfZyKlBI8=
|
||||
golang.org/x/net v0.38.0/go.mod h1:ivrbrMbzFq5J41QOQh0siUuly180yBYtLp+CKbEaFx8=
|
||||
golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U=
|
||||
golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
|
||||
golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
|
||||
@@ -1440,8 +1446,8 @@ golang.org/x/sys v0.18.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
|
||||
golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
|
||||
golang.org/x/sys v0.21.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
|
||||
golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
|
||||
golang.org/x/sys v0.31.0 h1:ioabZlmFYtWhL+TRYpcnNlLwhyxaM9kWTDEmfnprqik=
|
||||
golang.org/x/sys v0.31.0/go.mod h1:BJP2sWEmIv4KK5OTEluFJCKSidICx8ciO85XgH3Ak8k=
|
||||
golang.org/x/sys v0.32.0 h1:s77OFDvIQeibCmezSnk/q6iAfkdiQaJi4VzroCFrN20=
|
||||
golang.org/x/sys v0.32.0/go.mod h1:BJP2sWEmIv4KK5OTEluFJCKSidICx8ciO85XgH3Ak8k=
|
||||
golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
|
||||
golang.org/x/term v0.0.0-20201117132131-f5c789dd3221/go.mod h1:Nr5EML6q2oocZ2LXRh80K7BxOlk5/8JxuGnuhpl+muw=
|
||||
golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
|
||||
@@ -1597,8 +1603,8 @@ google.golang.org/genproto v0.0.0-20200618031413-b414f8b61790/go.mod h1:jDfRM7Fc
|
||||
google.golang.org/genproto v0.0.0-20200729003335-053ba62fc06f/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
|
||||
google.golang.org/genproto v0.0.0-20200804131852-c06518451d9c/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
|
||||
google.golang.org/genproto v0.0.0-20200825200019-8632dd797987/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
|
||||
google.golang.org/genproto v0.0.0-20241118233622-e639e219e697 h1:ToEetK57OidYuqD4Q5w+vfEnPvPpuTwedCNVohYJfNk=
|
||||
google.golang.org/genproto v0.0.0-20241118233622-e639e219e697/go.mod h1:JJrvXBWRZaFMxBufik1a4RpFw4HhgVtBBWQeQgUj2cc=
|
||||
google.golang.org/genproto v0.0.0-20250303144028-a0af3efb3deb h1:ITgPrl429bc6+2ZraNSzMDk3I95nmQln2fuPstKwFDE=
|
||||
google.golang.org/genproto v0.0.0-20250303144028-a0af3efb3deb/go.mod h1:sAo5UzpjUwgFBCzupwhcLcxHVDK7vG5IqI30YnwX2eE=
|
||||
google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb h1:p31xT4yrYrSM/G4Sn2+TNUkVhFCbG9y8itM2S6Th950=
|
||||
google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb/go.mod h1:jbe3Bkdp+Dh2IrslsFCklNhweNTBgSYanP1UXhJDhKg=
|
||||
google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb h1:TLPQVbx1GJ8VKZxz52VAxl1EBgKXXbTiU9Fc5fZeLn4=
|
||||
@@ -1618,8 +1624,8 @@ google.golang.org/grpc v1.29.1/go.mod h1:itym6AZVZYACWQqET3MqgPpjcuV5QH3BxFS3Iji
|
||||
google.golang.org/grpc v1.30.0/go.mod h1:N36X2cJ7JwdamYAgDz+s+rVMFjt3numwzf/HckM8pak=
|
||||
google.golang.org/grpc v1.31.0/go.mod h1:N36X2cJ7JwdamYAgDz+s+rVMFjt3numwzf/HckM8pak=
|
||||
google.golang.org/grpc v1.33.2/go.mod h1:JMHMWHQWaTccqQQlmk3MJZS+GWXOdAesneDmEnv2fbc=
|
||||
google.golang.org/grpc v1.71.0 h1:kF77BGdPTQ4/JZWMlb9VpJ5pa25aqvVqogsxNHHdeBg=
|
||||
google.golang.org/grpc v1.71.0/go.mod h1:H0GRtasmQOh9LkFoCPDu3ZrwUtD1YGE+b2vYBYd/8Ec=
|
||||
google.golang.org/grpc v1.71.1 h1:ffsFWr7ygTUscGPI0KKK6TLrGz0476KUvvsbqWK0rPI=
|
||||
google.golang.org/grpc v1.71.1/go.mod h1:H0GRtasmQOh9LkFoCPDu3ZrwUtD1YGE+b2vYBYd/8Ec=
|
||||
google.golang.org/grpc/examples v0.0.0-20211102180624-670c133e568e h1:m7aQHHqd0q89mRwhwS9Bx2rjyl/hsFAeta+uGrHsQaU=
|
||||
google.golang.org/grpc/examples v0.0.0-20211102180624-670c133e568e/go.mod h1:gID3PKrg7pWKntu9Ss6zTLJ0ttC0X9IHgREOCZwbCVU=
|
||||
google.golang.org/protobuf v0.0.0-20200109180630-ec00e32a8dfd/go.mod h1:DFci5gLYBciE7Vtevhsrf46CRTquxDuWsQurQQe4oz8=
|
||||
@@ -1636,8 +1642,8 @@ google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp0
|
||||
google.golang.org/protobuf v1.26.0/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc=
|
||||
google.golang.org/protobuf v1.28.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
|
||||
google.golang.org/protobuf v1.28.1/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
|
||||
google.golang.org/protobuf v1.36.5 h1:tPhr+woSbjfYvY6/GPufUoYizxw1cF/yFoxJ2fmpwlM=
|
||||
google.golang.org/protobuf v1.36.5/go.mod h1:9fA7Ob0pmnwhb644+1+CVWFRbNajQ6iRojtC/QF5bRE=
|
||||
google.golang.org/protobuf v1.36.6 h1:z1NpPI8ku2WgiWnf+t9wTPsn6eP1L7ksHUlkfLvd9xY=
|
||||
google.golang.org/protobuf v1.36.6/go.mod h1:jduwjTPXsFjZGTmRluh+L6NjiWu7pchiJ2/5YcXBHnY=
|
||||
gopkg.in/alecthomas/kingpin.v2 v2.2.6/go.mod h1:FMv+mEhP44yOT+4EoQTLFTRgOQ1FBLkstjWtayDeSgw=
|
||||
gopkg.in/cenkalti/backoff.v1 v1.1.0 h1:Arh75ttbsvlpVA7WtVpH4u9h6Zl46xuptxqLxPiSo4Y=
|
||||
gopkg.in/cenkalti/backoff.v1 v1.1.0/go.mod h1:J6Vskwqd+OMVJl8C33mmtxTBs2gyzfv7UDAkHu8BrjI=
|
||||
|
||||
@@ -2716,7 +2716,7 @@ var (
|
||||
|
||||
// errMaxExprCnt is used to signal that the maximum number of
|
||||
// expressions have been parsed.
|
||||
errMaxExprCnt = errors.New("max number of expresssions parsed")
|
||||
errMaxExprCnt = errors.New("max number of expressions parsed")
|
||||
)
|
||||
|
||||
// Option is a function that can set an option on the parser. It returns
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -16,7 +16,7 @@ var (
|
||||
// LatestTag is the latest released version plus the dev meta version.
|
||||
// Will be overwritten by the release pipeline
|
||||
// Needs a manual change for every tagged release
|
||||
LatestTag = "1.1.0+dev"
|
||||
LatestTag = "2.1.0+dev"
|
||||
|
||||
// Date indicates the build date.
|
||||
// This has been removed, it looks like you can only replace static strings with recent go versions
|
||||
@@ -46,18 +46,17 @@ func GetString() string {
|
||||
// Parsed returns a semver Version
|
||||
func Parsed() (version *semver.Version) {
|
||||
versionToParse := LatestTag
|
||||
if Tag != "" {
|
||||
// use the placeholder version if the tag is empty or when we are creating a daily build
|
||||
if Tag != "" && Tag != "daily" {
|
||||
versionToParse = Tag
|
||||
}
|
||||
version, err := semver.NewVersion(versionToParse)
|
||||
// We have no semver version but a commitid
|
||||
if err != nil {
|
||||
// this should never happen
|
||||
if err != nil {
|
||||
return &semver.Version{}
|
||||
}
|
||||
return &semver.Version{}
|
||||
}
|
||||
if String != "" {
|
||||
// We have no tagged version but a commitid
|
||||
nVersion, err := version.SetMetadata(String)
|
||||
if err != nil {
|
||||
return &semver.Version{}
|
||||
|
||||
@@ -1,49 +1,124 @@
|
||||
export default {
|
||||
changeTypes: [
|
||||
{
|
||||
title: '💥 Breaking changes',
|
||||
labels: ['breaking', 'Type:Breaking-Change'],
|
||||
bump: 'major',
|
||||
weight: 3
|
||||
},
|
||||
{
|
||||
title: '🔒 Security',
|
||||
labels: ['security', 'Type:Security'],
|
||||
bump: 'patch',
|
||||
weight: 2
|
||||
},
|
||||
{
|
||||
title: '✨ Features',
|
||||
labels: ['feature', 'Type:Feature'],
|
||||
bump: 'minor',
|
||||
weight: 1
|
||||
},
|
||||
{
|
||||
title: '📈 Enhancement',
|
||||
labels: ['enhancement', 'refactor', 'Type:Enhancement'],
|
||||
bump: 'minor'
|
||||
},
|
||||
{
|
||||
title: '🐛 Bug Fixes',
|
||||
labels: ['bug', 'Type:Bug'],
|
||||
bump: 'patch'
|
||||
},
|
||||
{
|
||||
title: '📚 Documentation',
|
||||
labels: ['docs', 'documentation', 'Type:Documentation'],
|
||||
bump: 'patch'
|
||||
},
|
||||
{
|
||||
title: '✅ Tests',
|
||||
labels: ['test', 'tests', 'Type:Test'],
|
||||
bump: 'patch'
|
||||
},
|
||||
{
|
||||
title: '📦️ Dependencies',
|
||||
labels: ['dependency', 'dependencies', 'Type:Dependencies'],
|
||||
bump: 'patch',
|
||||
weight: -1
|
||||
}
|
||||
],
|
||||
useVersionPrefixV: true,
|
||||
}
|
||||
changeTypes: [
|
||||
{
|
||||
title: "💥 Breaking changes",
|
||||
labels: ["breaking", "Type:Breaking-Change"],
|
||||
bump: "major",
|
||||
weight: 3,
|
||||
},
|
||||
{
|
||||
title: "🔒 Security",
|
||||
labels: ["security", "Type:Security"],
|
||||
bump: "patch",
|
||||
weight: 2,
|
||||
},
|
||||
{
|
||||
title: "✨ Features",
|
||||
labels: ["feature", "Type:Feature"],
|
||||
bump: "minor",
|
||||
weight: 1,
|
||||
},
|
||||
{
|
||||
title: "📈 Enhancement",
|
||||
labels: ["enhancement", "refactor", "Type:Enhancement"],
|
||||
bump: "minor",
|
||||
},
|
||||
{
|
||||
title: "🐛 Bug Fixes",
|
||||
labels: ["bug", "Type:Bug"],
|
||||
bump: "patch",
|
||||
},
|
||||
{
|
||||
title: "📚 Documentation",
|
||||
labels: ["docs", "documentation", "Type:Documentation"],
|
||||
bump: "patch",
|
||||
},
|
||||
{
|
||||
title: "✅ Tests",
|
||||
labels: ["test", "tests", "Type:Test"],
|
||||
bump: "patch",
|
||||
},
|
||||
{
|
||||
title: "📦️ Dependencies",
|
||||
labels: ["dependency", "dependencies", "Type:Dependencies"],
|
||||
bump: "patch",
|
||||
weight: -1,
|
||||
},
|
||||
],
|
||||
useVersionPrefixV: true,
|
||||
getLatestTag: ({ exec }) => {
|
||||
// the plugin uses the latest tag to determine the next version
|
||||
// and the changes that are included in the upcoming release.
|
||||
const branch = getBranch(exec);
|
||||
let tags = getTags(exec);
|
||||
|
||||
if (branch.startsWith("stable-")) {
|
||||
const [_, majorAndMinor] = branch.split("-");
|
||||
// we only care about tags that are within the range of the current stable branch.
|
||||
// e.g. if the branch is stable-1.2, we only care about tags that are v1.2.x.
|
||||
const matchingTags = tags.filter((t) =>
|
||||
t.startsWith(`v${majorAndMinor}`)
|
||||
);
|
||||
|
||||
if (matchingTags.length) {
|
||||
tags = matchingTags;
|
||||
}
|
||||
}
|
||||
|
||||
return tags.pop() || "v0.0.0";
|
||||
},
|
||||
useLatestRelease: ({ exec, nextVersion }) => {
|
||||
// check if the release should be marked as latest release on GitHub.
|
||||
const tags = getTags(exec);
|
||||
const latestTag = tags.pop() || "v0.0.0";
|
||||
return compareVersions(latestTag, nextVersion) === -1;
|
||||
},
|
||||
};
|
||||
|
||||
const parseVersion = (tag: string) => {
|
||||
const version = tag.startsWith("v") ? tag.slice(1) : tag;
|
||||
const [main, pre] = version.split("-");
|
||||
const [major, minor, patch] = main.split(".").map(Number);
|
||||
return { major, minor, patch, pre };
|
||||
};
|
||||
|
||||
const getBranch = (exec: any): string => {
|
||||
return exec("git rev-parse --abbrev-ref HEAD", {
|
||||
silent: true,
|
||||
}).stdout.trim();
|
||||
};
|
||||
|
||||
const getTags = (exec: any) => {
|
||||
exec("git fetch --tags", { silent: true });
|
||||
const tagsOutput = exec("git tag", { silent: true }).stdout.trim();
|
||||
const tags: string[] = tagsOutput ? tagsOutput.split("\n") : [];
|
||||
return tags.filter((tag) => tag.startsWith("v")).sort(compareVersions);
|
||||
};
|
||||
|
||||
const compareVersions = (a: string, b: string) => {
|
||||
const va = parseVersion(a);
|
||||
const vb = parseVersion(b);
|
||||
|
||||
if (va.major !== vb.major) {
|
||||
return va.major - vb.major;
|
||||
}
|
||||
if (va.minor !== vb.minor) {
|
||||
return va.minor - vb.minor;
|
||||
}
|
||||
if (va.patch !== vb.patch) {
|
||||
return va.patch - vb.patch;
|
||||
}
|
||||
|
||||
if (va.pre && !vb.pre) {
|
||||
return -1;
|
||||
}
|
||||
if (!va.pre && vb.pre) {
|
||||
return 1;
|
||||
}
|
||||
|
||||
if (va.pre && vb.pre) {
|
||||
return va.pre.localeCompare(vb.pre);
|
||||
}
|
||||
|
||||
return 0;
|
||||
};
|
||||
|
||||
@@ -4,7 +4,10 @@ The `antivirus` service is responsible for scanning files for viruses.
|
||||
|
||||
## Memory Considerations
|
||||
|
||||
The antivirus service can consume considerably amounts of memory. This is relevant to provide or define sufficient memory for the deployment selected. To avoid out of memory (OOM) situations, the following equation gives a rough overview based on experiences made. The memory calculation comes without any guarantee, is intended as overview only and subject of change.
|
||||
The antivirus service can consume considerable amounts of memory.
|
||||
This is relevant to provide or define sufficient memory for the deployment selected.
|
||||
To avoid out of memory (OOM) situations, the following equation gives a rough overview based on experiences made.
|
||||
The memory calculation comes without any guarantee, is intended as overview only and subject of change.
|
||||
|
||||
`memory limit` = `max file size` x `workers` x `factor 8 - 14`
|
||||
|
||||
@@ -19,17 +22,31 @@ With:
|
||||
|
||||
### Antivirus Scanner Type
|
||||
|
||||
The antivirus service currently supports [ICAP](https://tools.ietf.org/html/rfc3507) and [ClamAV](http://www.clamav.net/index.html) as antivirus scanners. The `ANTIVIRUS_SCANNER_TYPE` environment variable is used to select the scanner. The detailed configuration for each scanner heavily depends on the scanner type selected. See the environment variables for more details.
|
||||
The antivirus service currently supports [ICAP](https://tools.ietf.org/html/rfc3507) and [ClamAV](http://www.clamav.net/index.html) as antivirus scanners.
|
||||
The `ANTIVIRUS_SCANNER_TYPE` environment variable is used to select the scanner.
|
||||
The detailed configuration for each scanner heavily depends on the scanner type selected.
|
||||
See the environment variables for more details.
|
||||
|
||||
- For `icap`, only scanners using the `X-Infection-Found` header are currently supported.
|
||||
- For `clamav` only local sockets can currently be configured.
|
||||
|
||||
### Maximum Scan Size
|
||||
|
||||
Several factors can make it necessary to limit the maximum filesize the antivirus service will use for scanning. Use the `ANTIVIRUS_MAX_SCAN_SIZE` environment variable to scan only a given amount of bytes. Obviously, it is recommended to scan the whole file, but several factors like scanner type and version, bandwidth, performance issues, etc. might make a limit necessary.
|
||||
Several factors can make it necessary to limit the maximum filesize the antivirus service uses for scanning.
|
||||
Use the `ANTIVIRUS_MAX_SCAN_SIZE` environment variable to scan only a given number of bytes,
|
||||
or to skip the whole resource.
|
||||
|
||||
Even if it's recommended to scan the whole file, several factors like scanner type and version,
|
||||
bandwidth, performance issues, etc. might make a limit necessary.
|
||||
|
||||
In such cases, the antivirus the max scan size mode can be handy, the following modes are available:
|
||||
|
||||
- `partial`: The file is scanned up to the given size. The rest of the file is not scanned. This is the default mode `ANTIVIRUS_MAX_SCAN_SIZE=partial`
|
||||
- `skip`: The file is skipped and not scanned. `ANTIVIRUS_MAX_SCAN_SIZE=skip`
|
||||
|
||||
**IMPORTANT**
|
||||
> Streaming of files to the virus scan service still [needs to be implemented](https://github.com/owncloud/ocis/issues/6803). To prevent OOM errors `ANTIVIRUS_MAX_SCAN_SIZE` needs to be set lower than available ram.
|
||||
> Streaming of files to the virus scan service still [needs to be implemented](https://github.com/owncloud/ocis/issues/6803).
|
||||
> To prevent OOM errors `ANTIVIRUS_MAX_SCAN_SIZE` needs to be set lower than available ram and or the maximum file size that can be scanned by the virus scanner.
|
||||
|
||||
### Antivirus Workers
|
||||
|
||||
@@ -41,7 +58,7 @@ The antivirus service allows three different ways of handling infected files. Th
|
||||
|
||||
- `delete`: (default): Infected files will be deleted immediately, further postprocessing is cancelled.
|
||||
- `abort`: (advanced option): Infected files will be kept, further postprocessing is cancelled. Files can be manually retrieved and inspected by an admin. To identify the file for further investigation, the antivirus service logs the abort/infected state including the file ID. The file is located in the `storage/users/uploads` folder of the OpenCloud data directory and persists until it is manually deleted by the admin via the [Manage Unfinished Uploads](https://github.com/opencloud-eu/opencloud/tree/main/services/storage-users#manage-unfinished-uploads) command.
|
||||
- `continue`: (obviously not recommended): Infected files will be marked via metadata as infected but postprocessing continues normally. Note: Infected Files are moved to their final destination and therefore not prevented from download which includes the risk of spreading viruses.
|
||||
- `continue`: (not recommended): Infected files will be marked via metadata as infected, but postprocessing continues normally. Note: Infected Files are moved to their final destination and therefore not prevented from download, which includes the risk of spreading viruses.
|
||||
|
||||
In all cases, a log entry is added declaring the infection and handling method and a notification via the `userlog` service sent.
|
||||
|
||||
|
||||
@@ -45,7 +45,7 @@ func Server(cfg *config.Config) *cli.Command {
|
||||
{
|
||||
svc, err := service.NewAntivirus(cfg, logger, traceProvider)
|
||||
if err != nil {
|
||||
return err
|
||||
return cli.Exit(err.Error(), 1)
|
||||
}
|
||||
|
||||
gr.Add(svc.Run, func(_ error) {
|
||||
|
||||
@@ -5,6 +5,26 @@ import (
|
||||
"time"
|
||||
)
|
||||
|
||||
// ScannerType gives info which scanner is used
|
||||
type ScannerType string
|
||||
|
||||
const (
|
||||
// ScannerTypeClamAV defines that clamav is used
|
||||
ScannerTypeClamAV ScannerType = "clamav"
|
||||
// ScannerTypeICap defines that icap is used
|
||||
ScannerTypeICap ScannerType = "icap"
|
||||
)
|
||||
|
||||
// MaxScanSizeMode defines the mode of handling files that exceed the maximum scan size
|
||||
type MaxScanSizeMode string
|
||||
|
||||
const (
|
||||
// MaxScanSizeModeSkip defines that files that are bigger than the max scan size will be skipped
|
||||
MaxScanSizeModeSkip MaxScanSizeMode = "skip"
|
||||
// MaxScanSizeModePartial defines that only the file up to the max size will be used
|
||||
MaxScanSizeModePartial MaxScanSizeMode = "partial"
|
||||
)
|
||||
|
||||
// Config combines all available configuration parts.
|
||||
type Config struct {
|
||||
File string
|
||||
@@ -20,8 +40,9 @@ type Config struct {
|
||||
Events Events
|
||||
Workers int `yaml:"workers" env:"ANTIVIRUS_WORKERS" desc:"The number of concurrent go routines that fetch events from the event queue." introductionVersion:"1.0.0"`
|
||||
|
||||
Scanner Scanner
|
||||
MaxScanSize string `yaml:"max-scan-size" env:"ANTIVIRUS_MAX_SCAN_SIZE" desc:"The maximum scan size the virus scanner can handle. Only this many bytes of a file will be scanned. 0 means unlimited and is the default. Usable common abbreviations: [KB, KiB, MB, MiB, GB, GiB, TB, TiB, PB, PiB, EB, EiB], example: 2GB." introductionVersion:"1.0.0"`
|
||||
Scanner Scanner
|
||||
MaxScanSize string `yaml:"max-scan-size" env:"ANTIVIRUS_MAX_SCAN_SIZE" desc:"The maximum scan size the virus scanner can handle.0 means unlimited. Usable common abbreviations: [KB, KiB, MB, MiB, GB, GiB, TB, TiB, PB, PiB, EB, EiB], example: 2GB." introductionVersion:"1.0.0"`
|
||||
MaxScanSizeMode MaxScanSizeMode `yaml:"max-scan-size-mode" env:"ANTIVIRUS_MAX_SCAN_SIZE_MODE" desc:"Defines the mode of handling files that exceed the maximum scan size. Supported options are: 'skip', which skips files that are bigger than the max scan size, and 'truncate' (default), which only uses the file up to the max size." introductionVersion:"2.1.0"`
|
||||
|
||||
Context context.Context `json:"-" yaml:"-"`
|
||||
|
||||
@@ -62,7 +83,7 @@ type Events struct {
|
||||
|
||||
// Scanner provides configuration options for the virus scanner
|
||||
type Scanner struct {
|
||||
Type string `yaml:"type" env:"ANTIVIRUS_SCANNER_TYPE" desc:"The antivirus scanner to use. Supported values are 'clamav' and 'icap'." introductionVersion:"1.0.0"`
|
||||
Type ScannerType `yaml:"type" env:"ANTIVIRUS_SCANNER_TYPE" desc:"The antivirus scanner to use. Supported values are 'clamav' and 'icap'." introductionVersion:"1.0.0"`
|
||||
|
||||
ClamAV ClamAV // only if Type == clamav
|
||||
ICAP ICAP // only if Type == icap
|
||||
@@ -70,7 +91,8 @@ type Scanner struct {
|
||||
|
||||
// ClamAV provides configuration option for clamav
|
||||
type ClamAV struct {
|
||||
Socket string `yaml:"socket" env:"ANTIVIRUS_CLAMAV_SOCKET" desc:"The socket clamav is running on. Note the default value is an example which needs adaption according your OS." introductionVersion:"1.0.0"`
|
||||
Socket string `yaml:"socket" env:"ANTIVIRUS_CLAMAV_SOCKET" desc:"The socket clamav is running on. Note the default value is an example which needs adaption according your OS." introductionVersion:"1.0.0"`
|
||||
Timeout time.Duration `yaml:"scan_timeout" env:"ANTIVIRUS_CLAMAV_SCAN_TIMEOUT" desc:"Scan timeout for the ClamAV client. Defaults to '5m' (5 minutes). See the Environment Variable Types description for more details." introductionVersion:"2.1.0"`
|
||||
}
|
||||
|
||||
// ICAP provides configuration options for icap
|
||||
|
||||
@@ -30,10 +30,15 @@ func DefaultConfig() *config.Config {
|
||||
},
|
||||
Workers: 10,
|
||||
InfectedFileHandling: "delete",
|
||||
// defaults from clamav sample conf: MaxScanSize=400M, MaxFileSize=100M, StreamMaxLength=100M
|
||||
// https://github.com/Cisco-Talos/clamav/blob/main/etc/clamd.conf.sample
|
||||
MaxScanSize: "100MB",
|
||||
MaxScanSizeMode: config.MaxScanSizeModePartial,
|
||||
Scanner: config.Scanner{
|
||||
Type: "clamav",
|
||||
Type: config.ScannerTypeClamAV,
|
||||
ClamAV: config.ClamAV{
|
||||
Socket: "/run/clamav/clamd.ctl",
|
||||
Socket: "/run/clamav/clamd.ctl",
|
||||
Timeout: 5 * time.Minute,
|
||||
},
|
||||
ICAP: config.ICAP{
|
||||
URL: "icap://127.0.0.1:1344",
|
||||
@@ -57,4 +62,9 @@ func EnsureDefaults(cfg *config.Config) {
|
||||
|
||||
// Sanitize sanitizes the configuration
|
||||
func Sanitize(cfg *config.Config) {
|
||||
defaultConfig := DefaultConfig()
|
||||
|
||||
if cfg.MaxScanSize == "" {
|
||||
cfg.MaxScanSize = defaultConfig.MaxScanSize
|
||||
}
|
||||
}
|
||||
|
||||
@@ -1,34 +1,51 @@
|
||||
package scanners
|
||||
|
||||
import (
|
||||
"fmt"
|
||||
"time"
|
||||
|
||||
"github.com/dutchcoders/go-clamd"
|
||||
)
|
||||
|
||||
// NewClamAV returns a Scanner talking to clamAV via socket
|
||||
func NewClamAV(socket string) *ClamAV {
|
||||
return &ClamAV{
|
||||
clamd: clamd.NewClamd(socket),
|
||||
func NewClamAV(socket string, timeout time.Duration) (*ClamAV, error) {
|
||||
c := clamd.NewClamd(socket)
|
||||
|
||||
if err := c.Ping(); err != nil {
|
||||
return nil, fmt.Errorf("%w: %w", ErrScannerNotReachable, err)
|
||||
}
|
||||
|
||||
return &ClamAV{
|
||||
clamd: clamd.NewClamd(socket),
|
||||
timeout: timeout,
|
||||
}, nil
|
||||
}
|
||||
|
||||
// ClamAV is a Scanner based on clamav
|
||||
type ClamAV struct {
|
||||
clamd *clamd.Clamd
|
||||
clamd *clamd.Clamd
|
||||
timeout time.Duration
|
||||
}
|
||||
|
||||
// Scan to fulfill Scanner interface
|
||||
func (s ClamAV) Scan(in Input) (Result, error) {
|
||||
ch, err := s.clamd.ScanStream(in.Body, make(chan bool))
|
||||
abort := make(chan bool, 1)
|
||||
defer close(abort)
|
||||
|
||||
ch, err := s.clamd.ScanStream(in.Body, abort)
|
||||
if err != nil {
|
||||
return Result{}, err
|
||||
}
|
||||
|
||||
r := <-ch
|
||||
return Result{
|
||||
Infected: r.Status == clamd.RES_FOUND,
|
||||
Description: r.Description,
|
||||
ScanTime: time.Now(),
|
||||
}, nil
|
||||
select {
|
||||
case <-time.After(s.timeout):
|
||||
abort <- true
|
||||
return Result{}, fmt.Errorf("%w: %s", ErrScanTimeout, in.Url)
|
||||
case s := <-ch:
|
||||
return Result{
|
||||
Infected: s.Status == clamd.RES_FOUND,
|
||||
Description: s.Description,
|
||||
ScanTime: time.Now(),
|
||||
}, nil
|
||||
}
|
||||
}
|
||||
|
||||
120
services/antivirus/pkg/scanners/clamav_test.go
Normal file
120
services/antivirus/pkg/scanners/clamav_test.go
Normal file
@@ -0,0 +1,120 @@
|
||||
package scanners_test
|
||||
|
||||
import (
|
||||
"context"
|
||||
"net"
|
||||
"os"
|
||||
"path/filepath"
|
||||
"strings"
|
||||
"testing"
|
||||
"time"
|
||||
|
||||
"github.com/stretchr/testify/assert"
|
||||
"github.com/stretchr/testify/require"
|
||||
|
||||
"github.com/opencloud-eu/opencloud/services/antivirus/pkg/scanners"
|
||||
)
|
||||
|
||||
func newUnixListener(t testing.TB, lc net.ListenConfig, v ...string) net.Listener {
|
||||
d, err := os.MkdirTemp("", "")
|
||||
assert.NoError(t, err)
|
||||
t.Cleanup(func() {
|
||||
require.NoError(t, os.RemoveAll(d))
|
||||
})
|
||||
|
||||
nl, err := lc.Listen(context.Background(), "unix", filepath.Join(d, "sock"))
|
||||
require.NoError(t, err)
|
||||
|
||||
go func() {
|
||||
i := 0
|
||||
for {
|
||||
if len(v) == i {
|
||||
break
|
||||
}
|
||||
|
||||
conn, err := nl.Accept()
|
||||
require.NoError(t, err)
|
||||
|
||||
time.Sleep(100 * time.Millisecond)
|
||||
|
||||
_, err = conn.Write([]byte(v[i]))
|
||||
require.NoError(t, err)
|
||||
require.NoError(t, conn.Close())
|
||||
i++
|
||||
}
|
||||
}()
|
||||
|
||||
return nl
|
||||
}
|
||||
|
||||
func TestNewClamAV(t *testing.T) {
|
||||
t.Run("returns a scanner", func(t *testing.T) {
|
||||
ul := newUnixListener(t, net.ListenConfig{}, "PONG\n")
|
||||
defer func() {
|
||||
assert.NoError(t, ul.Close())
|
||||
}()
|
||||
|
||||
done := make(chan bool, 1)
|
||||
|
||||
go func() {
|
||||
_, err := scanners.NewClamAV(ul.Addr().String(), 10*time.Second)
|
||||
assert.NoError(t, err)
|
||||
done <- true
|
||||
}()
|
||||
|
||||
assert.True(t, <-done)
|
||||
})
|
||||
|
||||
t.Run("fails if scanner is not pingable", func(t *testing.T) {
|
||||
_, err := scanners.NewClamAV("", 0)
|
||||
assert.ErrorIs(t, err, scanners.ErrScannerNotReachable)
|
||||
})
|
||||
}
|
||||
|
||||
func TestNewClamAV_Scan(t *testing.T) {
|
||||
t.Run("returns a result", func(t *testing.T) {
|
||||
ul := newUnixListener(t, net.ListenConfig{}, "PONG\n", "stream: Win.Test.EICAR_HDB-1 FOUND\n")
|
||||
defer func() {
|
||||
assert.NoError(t, ul.Close())
|
||||
}()
|
||||
|
||||
done := make(chan bool, 1)
|
||||
|
||||
go func() {
|
||||
scanner, err := scanners.NewClamAV(ul.Addr().String(), 10*time.Second)
|
||||
assert.NoError(t, err)
|
||||
|
||||
result, err := scanner.Scan(scanners.Input{Body: strings.NewReader("DATA")})
|
||||
assert.NoError(t, err)
|
||||
|
||||
assert.Equal(t, result.Description, "Win.Test.EICAR_HDB-1")
|
||||
assert.True(t, result.Infected)
|
||||
done <- true
|
||||
}()
|
||||
|
||||
assert.True(t, <-done)
|
||||
})
|
||||
|
||||
t.Run("aborts after a certain time", func(t *testing.T) {
|
||||
ul := newUnixListener(t, net.ListenConfig{}, "PONG\n", "stream: Win.Test.EICAR_HDB-1 FOUND\n")
|
||||
defer func() {
|
||||
assert.NoError(t, ul.Close())
|
||||
}()
|
||||
|
||||
done := make(chan bool, 1)
|
||||
|
||||
go func() {
|
||||
scanner, err := scanners.NewClamAV(ul.Addr().String(), 10*time.Second)
|
||||
assert.NoError(t, err)
|
||||
|
||||
result, err := scanner.Scan(scanners.Input{Body: strings.NewReader("DATA")})
|
||||
assert.NoError(t, err)
|
||||
|
||||
assert.Equal(t, result.Description, "Win.Test.EICAR_HDB-1")
|
||||
assert.True(t, result.Infected)
|
||||
done <- true
|
||||
}()
|
||||
|
||||
assert.True(t, <-done)
|
||||
})
|
||||
}
|
||||
@@ -1,21 +1,31 @@
|
||||
package scanners
|
||||
|
||||
import (
|
||||
"errors"
|
||||
"io"
|
||||
"time"
|
||||
)
|
||||
|
||||
// The Result is the common scan result to all scanners
|
||||
type Result struct {
|
||||
Infected bool
|
||||
ScanTime time.Time
|
||||
Description string
|
||||
}
|
||||
var (
|
||||
// ErrScanTimeout is returned when a scan times out
|
||||
ErrScanTimeout = errors.New("time out waiting for clamav to respond while scanning")
|
||||
// ErrScannerNotReachable is returned when the scanner is not reachable
|
||||
ErrScannerNotReachable = errors.New("failed to reach the scanner")
|
||||
)
|
||||
|
||||
// The Input is the common input to all scanners
|
||||
type Input struct {
|
||||
Body io.Reader
|
||||
Size int64
|
||||
Url string
|
||||
Name string
|
||||
}
|
||||
type (
|
||||
// The Result is the common scan result to all scanners
|
||||
Result struct {
|
||||
Infected bool
|
||||
ScanTime time.Time
|
||||
Description string
|
||||
}
|
||||
|
||||
// The Input is the common input to all scanners
|
||||
Input struct {
|
||||
Body io.Reader
|
||||
Size int64
|
||||
Url string
|
||||
Name string
|
||||
}
|
||||
)
|
||||
|
||||
@@ -9,6 +9,7 @@ import (
|
||||
"io"
|
||||
"net/http"
|
||||
"os"
|
||||
"slices"
|
||||
"sync"
|
||||
"time"
|
||||
|
||||
@@ -37,38 +38,44 @@ type Scanner interface {
|
||||
}
|
||||
|
||||
// NewAntivirus returns a service implementation for Service.
|
||||
func NewAntivirus(c *config.Config, l log.Logger, tp trace.TracerProvider) (Antivirus, error) {
|
||||
|
||||
func NewAntivirus(cfg *config.Config, logger log.Logger, tracerProvider trace.TracerProvider) (Antivirus, error) {
|
||||
var scanner Scanner
|
||||
var err error
|
||||
switch c.Scanner.Type {
|
||||
switch cfg.Scanner.Type {
|
||||
default:
|
||||
return Antivirus{}, fmt.Errorf("unknown av scanner: '%s'", c.Scanner.Type)
|
||||
case "clamav":
|
||||
scanner = scanners.NewClamAV(c.Scanner.ClamAV.Socket)
|
||||
case "icap":
|
||||
scanner, err = scanners.NewICAP(c.Scanner.ICAP.URL, c.Scanner.ICAP.Service, c.Scanner.ICAP.Timeout)
|
||||
return Antivirus{}, fmt.Errorf("unknown av scanner: '%s'", cfg.Scanner.Type)
|
||||
case config.ScannerTypeClamAV:
|
||||
scanner, err = scanners.NewClamAV(cfg.Scanner.ClamAV.Socket, cfg.Scanner.ClamAV.Timeout)
|
||||
case config.ScannerTypeICap:
|
||||
scanner, err = scanners.NewICAP(cfg.Scanner.ICAP.URL, cfg.Scanner.ICAP.Service, cfg.Scanner.ICAP.Timeout)
|
||||
}
|
||||
if err != nil {
|
||||
return Antivirus{}, err
|
||||
}
|
||||
|
||||
av := Antivirus{c: c, l: l, tp: tp, s: scanner, client: rhttp.GetHTTPClient(rhttp.Insecure(true))}
|
||||
av := Antivirus{config: cfg, log: logger, tracerProvider: tracerProvider, scanner: scanner, client: rhttp.GetHTTPClient(rhttp.Insecure(true))}
|
||||
|
||||
switch o := events.PostprocessingOutcome(c.InfectedFileHandling); o {
|
||||
case events.PPOutcomeContinue, events.PPOutcomeAbort, events.PPOutcomeDelete:
|
||||
av.o = o
|
||||
switch mode := cfg.MaxScanSizeMode; mode {
|
||||
case config.MaxScanSizeModeSkip, config.MaxScanSizeModePartial:
|
||||
break
|
||||
default:
|
||||
return av, fmt.Errorf("unknown infected file handling '%s'", o)
|
||||
return av, fmt.Errorf("unknown max scan size mode '%s'", cfg.MaxScanSizeMode)
|
||||
}
|
||||
|
||||
if c.MaxScanSize != "" {
|
||||
b, err := bytesize.Parse(c.MaxScanSize)
|
||||
switch outcome := events.PostprocessingOutcome(cfg.InfectedFileHandling); outcome {
|
||||
case events.PPOutcomeContinue, events.PPOutcomeAbort, events.PPOutcomeDelete:
|
||||
av.outcome = outcome
|
||||
default:
|
||||
return av, fmt.Errorf("unknown infected file handling '%s'", outcome)
|
||||
}
|
||||
|
||||
if cfg.MaxScanSize != "" {
|
||||
b, err := bytesize.Parse(cfg.MaxScanSize)
|
||||
if err != nil {
|
||||
return av, err
|
||||
}
|
||||
|
||||
av.m = b.Bytes()
|
||||
av.maxScanSize = b.Bytes()
|
||||
}
|
||||
|
||||
return av, nil
|
||||
@@ -76,23 +83,23 @@ func NewAntivirus(c *config.Config, l log.Logger, tp trace.TracerProvider) (Anti
|
||||
|
||||
// Antivirus defines implements the business logic for Service.
|
||||
type Antivirus struct {
|
||||
c *config.Config
|
||||
l log.Logger
|
||||
s Scanner
|
||||
o events.PostprocessingOutcome
|
||||
m uint64
|
||||
tp trace.TracerProvider
|
||||
config *config.Config
|
||||
log log.Logger
|
||||
scanner Scanner
|
||||
outcome events.PostprocessingOutcome
|
||||
maxScanSize uint64
|
||||
tracerProvider trace.TracerProvider
|
||||
|
||||
client *http.Client
|
||||
}
|
||||
|
||||
// Run runs the service
|
||||
func (av Antivirus) Run() error {
|
||||
evtsCfg := av.c.Events
|
||||
eventsCfg := av.config.Events
|
||||
|
||||
var rootCAPool *x509.CertPool
|
||||
if av.c.Events.TLSRootCACertificate != "" {
|
||||
rootCrtFile, err := os.Open(evtsCfg.TLSRootCACertificate)
|
||||
if av.config.Events.TLSRootCACertificate != "" {
|
||||
rootCrtFile, err := os.Open(eventsCfg.TLSRootCACertificate)
|
||||
if err != nil {
|
||||
return err
|
||||
}
|
||||
@@ -104,10 +111,10 @@ func (av Antivirus) Run() error {
|
||||
|
||||
rootCAPool = x509.NewCertPool()
|
||||
rootCAPool.AppendCertsFromPEM(certBytes.Bytes())
|
||||
av.c.Events.TLSInsecure = false
|
||||
av.config.Events.TLSInsecure = false
|
||||
}
|
||||
|
||||
natsStream, err := stream.NatsFromConfig(av.c.Service.Name, false, stream.NatsConfig(av.c.Events))
|
||||
natsStream, err := stream.NatsFromConfig(av.config.Service.Name, false, stream.NatsConfig(av.config.Events))
|
||||
if err != nil {
|
||||
return err
|
||||
}
|
||||
@@ -118,7 +125,7 @@ func (av Antivirus) Run() error {
|
||||
}
|
||||
|
||||
wg := sync.WaitGroup{}
|
||||
for i := 0; i < av.c.Workers; i++ {
|
||||
for i := 0; i < av.config.Workers; i++ {
|
||||
wg.Add(1)
|
||||
go func() {
|
||||
defer wg.Done()
|
||||
@@ -127,11 +134,11 @@ func (av Antivirus) Run() error {
|
||||
if err != nil {
|
||||
switch {
|
||||
case errors.Is(err, ErrFatal):
|
||||
av.l.Fatal().Err(err).Msg("fatal error - exiting")
|
||||
av.log.Fatal().Err(err).Msg("fatal error - exiting")
|
||||
case errors.Is(err, ErrEvent):
|
||||
av.l.Error().Err(err).Msg("continuing")
|
||||
av.log.Error().Err(err).Msg("continuing")
|
||||
default:
|
||||
av.l.Fatal().Err(err).Msg("unknown error - exiting")
|
||||
av.log.Fatal().Err(err).Msg("unknown error - exiting")
|
||||
}
|
||||
}
|
||||
}
|
||||
@@ -143,20 +150,20 @@ func (av Antivirus) Run() error {
|
||||
}
|
||||
|
||||
func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
ctx := e.GetTraceContext(context.Background())
|
||||
ctx, span := av.tp.Tracer("antivirus").Start(ctx, "processEvent")
|
||||
ctx, span := av.tracerProvider.Tracer("antivirus").Start(e.GetTraceContext(context.Background()), "processEvent")
|
||||
defer span.End()
|
||||
av.l.Info().Str("traceID", span.SpanContext().TraceID().String()).Msg("TraceID")
|
||||
av.log.Info().Str("traceID", span.SpanContext().TraceID().String()).Msg("TraceID")
|
||||
|
||||
ev := e.Event.(events.StartPostprocessingStep)
|
||||
if ev.StepToStart != events.PPStepAntivirus {
|
||||
return nil
|
||||
}
|
||||
|
||||
if av.c.DebugScanOutcome != "" {
|
||||
av.l.Warn().Str("antivir, clamav", ">>>>>>> ANTIVIRUS_DEBUG_SCAN_OUTCOME IS SET NO ACTUAL VIRUS SCAN IS PERFORMED!").Send()
|
||||
if av.config.DebugScanOutcome != "" {
|
||||
av.log.Warn().Str("antivir, clamav", ">>>>>>> ANTIVIRUS_DEBUG_SCAN_OUTCOME IS SET NO ACTUAL VIRUS SCAN IS PERFORMED!").Send()
|
||||
if err := events.Publish(ctx, s, events.PostprocessingStepFinished{
|
||||
FinishedStep: events.PPStepAntivirus,
|
||||
Outcome: events.PostprocessingOutcome(av.c.DebugScanOutcome),
|
||||
Outcome: events.PostprocessingOutcome(av.config.DebugScanOutcome),
|
||||
UploadID: ev.UploadID,
|
||||
ExecutingUser: ev.ExecutingUser,
|
||||
Filename: ev.Filename,
|
||||
@@ -167,13 +174,14 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
ResourceID: ev.ResourceID,
|
||||
},
|
||||
}); err != nil {
|
||||
av.l.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
|
||||
av.log.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
|
||||
return fmt.Errorf("%w: cannot publish events", ErrFatal)
|
||||
}
|
||||
return fmt.Errorf("%w: no actual virus scan performed", ErrEvent)
|
||||
}
|
||||
|
||||
av.l.Debug().Str("uploadid", ev.UploadID).Str("filename", ev.Filename).Msg("Starting virus scan.")
|
||||
av.log.Debug().Str("uploadid", ev.UploadID).Str("filename", ev.Filename).Msg("Starting virus scan.")
|
||||
|
||||
var errmsg string
|
||||
start := time.Now()
|
||||
res, err := av.process(ev)
|
||||
@@ -185,17 +193,17 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
var outcome events.PostprocessingOutcome
|
||||
switch {
|
||||
case res.Infected:
|
||||
outcome = av.o
|
||||
outcome = av.outcome
|
||||
case !res.Infected && err == nil:
|
||||
outcome = events.PPOutcomeContinue
|
||||
case err != nil:
|
||||
outcome = events.PPOutcomeRetry
|
||||
default:
|
||||
// Not sure what this is about. abort.
|
||||
// Not sure what this is about. Abort.
|
||||
outcome = events.PPOutcomeAbort
|
||||
}
|
||||
|
||||
av.l.Info().Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Str("virus", res.Description).Str("outcome", string(outcome)).Str("filename", ev.Filename).Str("user", ev.ExecutingUser.GetId().GetOpaqueId()).Bool("infected", res.Infected).Dur("duration", duration).Msg("File scanned")
|
||||
av.log.Info().Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Str("virus", res.Description).Str("outcome", string(outcome)).Str("filename", ev.Filename).Str("user", ev.ExecutingUser.GetId().GetOpaqueId()).Bool("infected", res.Infected).Dur("duration", duration).Msg("File scanned")
|
||||
if err := events.Publish(ctx, s, events.PostprocessingStepFinished{
|
||||
FinishedStep: events.PPStepAntivirus,
|
||||
Outcome: outcome,
|
||||
@@ -210,7 +218,7 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
ErrorMsg: errmsg,
|
||||
},
|
||||
}); err != nil {
|
||||
av.l.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
|
||||
av.log.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
|
||||
return fmt.Errorf("%w: %s", ErrFatal, err)
|
||||
}
|
||||
return nil
|
||||
@@ -218,11 +226,24 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
|
||||
// process the scan
|
||||
func (av Antivirus) process(ev events.StartPostprocessingStep) (scanners.Result, error) {
|
||||
if ev.Filesize == 0 || (0 < av.m && av.m < ev.Filesize) {
|
||||
av.l.Info().Str("uploadid", ev.UploadID).Uint64("limit", av.m).Uint64("filesize", ev.Filesize).Msg("Skipping file to be virus scanned because its file size is higher than the defined limit.")
|
||||
return scanners.Result{
|
||||
ScanTime: time.Now(),
|
||||
}, nil
|
||||
if ev.Filesize == 0 {
|
||||
av.log.Info().Str("uploadid", ev.UploadID).Msg("Skipping file to be virus scanned, file size is 0.")
|
||||
return scanners.Result{ScanTime: time.Now()}, nil
|
||||
}
|
||||
|
||||
headers := make(map[string]string)
|
||||
switch {
|
||||
case av.maxScanSize == 0:
|
||||
// there is no size limit
|
||||
break
|
||||
case av.config.MaxScanSizeMode == config.MaxScanSizeModeSkip && ev.Filesize > av.maxScanSize:
|
||||
// skip the file if it is bigger than the max scan size
|
||||
av.log.Info().Str("uploadid", ev.UploadID).Uint64("filesize", ev.Filesize).
|
||||
Msg("Skipping file to be virus scanned, file size is bigger than max scan size.")
|
||||
return scanners.Result{ScanTime: time.Now()}, nil
|
||||
case av.config.MaxScanSizeMode == config.MaxScanSizeModePartial && ev.Filesize > av.maxScanSize:
|
||||
// set the range header to only download the first maxScanSize bytes
|
||||
headers["Range"] = fmt.Sprintf("bytes=0-%d", av.maxScanSize-1)
|
||||
}
|
||||
|
||||
var err error
|
||||
@@ -230,56 +251,61 @@ func (av Antivirus) process(ev events.StartPostprocessingStep) (scanners.Result,
|
||||
|
||||
switch ev.UploadID {
|
||||
default:
|
||||
rrc, err = av.downloadViaToken(ev.URL)
|
||||
rrc, err = av.downloadViaToken(ev.URL, headers)
|
||||
case "":
|
||||
rrc, err = av.downloadViaReva(ev.URL, ev.Token, ev.RevaToken)
|
||||
rrc, err = av.downloadViaReva(ev.URL, ev.Token, ev.RevaToken, headers)
|
||||
}
|
||||
if err != nil {
|
||||
av.l.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error downloading file")
|
||||
av.log.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error downloading file")
|
||||
return scanners.Result{}, err
|
||||
}
|
||||
defer rrc.Close()
|
||||
av.l.Debug().Str("uploadid", ev.UploadID).Msg("Downloaded file successfully, starting virusscan")
|
||||
defer func() {
|
||||
_ = rrc.Close()
|
||||
}()
|
||||
|
||||
res, err := av.s.Scan(scanners.Input{Body: rrc, Size: int64(ev.Filesize), Url: ev.URL, Name: ev.Filename})
|
||||
av.log.Debug().Str("uploadid", ev.UploadID).Msg("Downloaded file successfully, starting virusscan")
|
||||
|
||||
res, err := av.scanner.Scan(scanners.Input{Body: rrc, Size: int64(ev.Filesize), Url: ev.URL, Name: ev.Filename})
|
||||
if err != nil {
|
||||
av.l.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error scanning file")
|
||||
av.log.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error scanning file")
|
||||
}
|
||||
|
||||
return res, err
|
||||
}
|
||||
|
||||
// download will download the file
|
||||
func (av Antivirus) downloadViaToken(url string) (io.ReadCloser, error) {
|
||||
func (av Antivirus) downloadViaToken(url string, headers map[string]string) (io.ReadCloser, error) {
|
||||
req, err := http.NewRequest(http.MethodGet, url, nil)
|
||||
if err != nil {
|
||||
return nil, err
|
||||
}
|
||||
|
||||
return av.doDownload(req)
|
||||
return av.doDownload(req, headers)
|
||||
}
|
||||
|
||||
// download will download the file
|
||||
func (av Antivirus) downloadViaReva(url string, dltoken string, revatoken string) (io.ReadCloser, error) {
|
||||
ctx := ctxpkg.ContextSetToken(context.Background(), revatoken)
|
||||
|
||||
req, err := rhttp.NewRequest(ctx, http.MethodGet, url, nil)
|
||||
func (av Antivirus) downloadViaReva(url string, dltoken string, revatoken string, headers map[string]string) (io.ReadCloser, error) {
|
||||
req, err := rhttp.NewRequest(ctxpkg.ContextSetToken(context.Background(), revatoken), http.MethodGet, url, nil)
|
||||
if err != nil {
|
||||
return nil, err
|
||||
}
|
||||
req.Header.Set("X-Reva-Transfer", dltoken)
|
||||
|
||||
return av.doDownload(req)
|
||||
return av.doDownload(req, headers)
|
||||
}
|
||||
|
||||
func (av Antivirus) doDownload(req *http.Request) (io.ReadCloser, error) {
|
||||
func (av Antivirus) doDownload(req *http.Request, headers map[string]string) (io.ReadCloser, error) {
|
||||
for k, v := range headers {
|
||||
req.Header.Add(k, v)
|
||||
}
|
||||
|
||||
res, err := av.client.Do(req)
|
||||
if err != nil {
|
||||
return nil, err
|
||||
}
|
||||
|
||||
if res.StatusCode != http.StatusOK {
|
||||
res.Body.Close()
|
||||
if !slices.Contains([]int{http.StatusOK, http.StatusPartialContent}, res.StatusCode) {
|
||||
_ = res.Body.Close()
|
||||
return nil, fmt.Errorf("unexpected status code from Download %v", res.StatusCode)
|
||||
}
|
||||
|
||||
|
||||
@@ -11,7 +11,6 @@ import (
|
||||
gateway "github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1"
|
||||
group "github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1"
|
||||
user "github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1"
|
||||
rpc "github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1"
|
||||
provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1"
|
||||
"go.opentelemetry.io/otel/trace"
|
||||
|
||||
@@ -219,33 +218,16 @@ func processShareEvent(ctx context.Context, ref *provider.Reference, gwc gateway
|
||||
|
||||
// custom logic for item trashed event
|
||||
func processItemTrashedEvent(ctx context.Context, ref *provider.Reference, gwc gateway.GatewayAPIClient, initiatorid string, itemID *provider.ResourceId) ([]string, FileEvent, error) {
|
||||
resp, err := gwc.ListRecycle(ctx, &provider.ListRecycleRequest{
|
||||
Ref: ref,
|
||||
Key: itemID.GetOpaqueId(),
|
||||
})
|
||||
if err != nil {
|
||||
return nil, FileEvent{}, err
|
||||
}
|
||||
if resp.GetStatus().GetCode() != rpc.Code_CODE_OK {
|
||||
return nil, FileEvent{}, fmt.Errorf("error listing recycle: %s", resp.GetStatus().GetMessage())
|
||||
data := FileEvent{
|
||||
ItemID: storagespace.FormatResourceID(itemID),
|
||||
// TODO: check with web if parentID is needed
|
||||
// ParentItemID: storagespace.FormatResourceID(*item.GetRef().GetResourceId()),
|
||||
SpaceID: storagespace.FormatStorageID(itemID.GetStorageId(), itemID.GetSpaceId()),
|
||||
InitiatorID: initiatorid,
|
||||
}
|
||||
|
||||
for _, item := range resp.GetRecycleItems() {
|
||||
if item.GetKey() == itemID.GetOpaqueId() {
|
||||
|
||||
data := FileEvent{
|
||||
ItemID: storagespace.FormatResourceID(itemID),
|
||||
// TODO: check with web if parentID is needed
|
||||
// ParentItemID: storagespace.FormatResourceID(*item.GetRef().GetResourceId()),
|
||||
SpaceID: storagespace.FormatStorageID(itemID.GetStorageId(), itemID.GetSpaceId()),
|
||||
InitiatorID: initiatorid,
|
||||
}
|
||||
|
||||
users, err := utils.GetSpaceMembers(ctx, itemID.GetSpaceId(), gwc, utils.ViewerRole)
|
||||
return users, data, err
|
||||
}
|
||||
}
|
||||
return nil, FileEvent{}, errors.New("item not found in recycle bin")
|
||||
users, err := utils.GetSpaceMembers(ctx, itemID.GetSpaceId(), gwc, utils.ViewerRole)
|
||||
return users, data, err
|
||||
}
|
||||
|
||||
// adds share related data to the FileEvent
|
||||
|
||||
@@ -34,6 +34,7 @@ type Config struct {
|
||||
EnableFederatedSharingIncoming bool `yaml:"enable_federated_sharing_incoming" env:"OC_ENABLE_OCM;FRONTEND_ENABLE_FEDERATED_SHARING_INCOMING" desc:"Changing this value is NOT supported. Enables support for incoming federated sharing for clients. The backend behaviour is not changed." introductionVersion:"1.0.0"`
|
||||
EnableFederatedSharingOutgoing bool `yaml:"enable_federated_sharing_outgoing" env:"OC_ENABLE_OCM;FRONTEND_ENABLE_FEDERATED_SHARING_OUTGOING" desc:"Changing this value is NOT supported. Enables support for outgoing federated sharing for clients. The backend behaviour is not changed." introductionVersion:"1.0.0"`
|
||||
SearchMinLength int `yaml:"search_min_length" env:"FRONTEND_SEARCH_MIN_LENGTH" desc:"Minimum number of characters to enter before a client should start a search for Share receivers. This setting can be used to customize the user experience if e.g too many results are displayed." introductionVersion:"1.0.0"`
|
||||
Edition string `yaml:"edition" env:"OC_EDITION;FRONTEND_EDITION" desc:"Edition of OpenCloud. Used for branding purposes." introductionVersion:"1.0.0"`
|
||||
DisableSSE bool `yaml:"disable_sse" env:"OC_DISABLE_SSE;FRONTEND_DISABLE_SSE" desc:"When set to true, clients are informed that the Server-Sent Events endpoint is not accessible." introductionVersion:"1.0.0"`
|
||||
DefaultLinkPermissions int `yaml:"default_link_permissions" env:"FRONTEND_DEFAULT_LINK_PERMISSIONS" desc:"Defines the default permissions a link is being created with. Possible values are 0 (= internal link, for instance members only) and 1 (= public link with viewer permissions). Defaults to 1." introductionVersion:"1.0.0"`
|
||||
|
||||
|
||||
@@ -87,6 +87,7 @@ func DefaultConfig() *config.Config {
|
||||
DefaultUploadProtocol: "tus",
|
||||
DefaultLinkPermissions: 1,
|
||||
SearchMinLength: 3,
|
||||
Edition: "",
|
||||
Checksums: config.Checksums{
|
||||
SupportedTypes: []string{"sha1", "md5", "adler32"},
|
||||
PreferredUploadType: "sha1",
|
||||
|
||||
@@ -208,6 +208,7 @@ func FrontendConfigFromStruct(cfg *config.Config, logger log.Logger) (map[string
|
||||
"needsDbUpgrade": false,
|
||||
"version": version.Legacy,
|
||||
"versionstring": version.LegacyString,
|
||||
"edition": cfg.Edition,
|
||||
"productname": "OpenCloud",
|
||||
"product": "OpenCloud",
|
||||
"productversion": version.GetString(),
|
||||
|
||||
@@ -83,6 +83,7 @@ func NewDriveItemPermissionsService(logger log.Logger, gatewaySelector pool.Sele
|
||||
gatewaySelector: gatewaySelector,
|
||||
identityCache: identityCache,
|
||||
config: config,
|
||||
availableRoles: unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(config.UnifiedRoles.AvailableRoles...)),
|
||||
},
|
||||
}, nil
|
||||
}
|
||||
|
||||
@@ -441,7 +441,6 @@ var _ = Describe("DriveItemPermissionsService", func() {
|
||||
})
|
||||
It("returns role denied", func() {
|
||||
statResponse.Info.PermissionSet = roleconversions.NewManagerRole().CS3ResourcePermissions()
|
||||
cfg.UnifiedRoles.AvailableRoles = []string{unifiedrole.UnifiedRoleViewerID, unifiedrole.UnifiedRoleDeniedID, unifiedrole.UnifiedRoleManagerID}
|
||||
listSharesResponse.Shares = []*collaboration.Share{
|
||||
{
|
||||
Id: &collaboration.ShareId{OpaqueId: "1"},
|
||||
@@ -465,11 +464,15 @@ var _ = Describe("DriveItemPermissionsService", func() {
|
||||
}
|
||||
listPublicSharesResponse.Share = []*link.PublicShare{}
|
||||
|
||||
cfg = defaults.FullDefaultConfig()
|
||||
cfg.UnifiedRoles.AvailableRoles = []string{unifiedrole.UnifiedRoleViewerID, unifiedrole.UnifiedRoleDeniedID, unifiedrole.UnifiedRoleManagerID}
|
||||
service, err := svc.NewDriveItemPermissionsService(log.NewLogger(), gatewaySelector, cache, cfg)
|
||||
|
||||
gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil)
|
||||
gatewayClient.On("ListShares", mock.Anything, mock.Anything).Return(listSharesResponse, nil)
|
||||
gatewayClient.On("GetUser", mock.Anything, mock.Anything).Return(getUserResponse, nil)
|
||||
gatewayClient.On("ListPublicShares", mock.Anything, mock.Anything).Return(listPublicSharesResponse, nil)
|
||||
permissions, err := driveItemPermissionsService.ListPermissions(context.Background(), itemID, false, false)
|
||||
permissions, err := service.ListPermissions(context.Background(), itemID, false, false)
|
||||
Expect(err).ToNot(HaveOccurred())
|
||||
Expect(len(permissions.LibreGraphPermissionsActionsAllowedValues)).ToNot(BeZero())
|
||||
Expect(len(permissions.LibreGraphPermissionsRolesAllowedValues)).ToNot(BeZero())
|
||||
|
||||
@@ -46,6 +46,7 @@ type BaseGraphService struct {
|
||||
gatewaySelector pool.Selectable[gateway.GatewayAPIClient]
|
||||
identityCache identity.IdentityCache
|
||||
config *config.Config
|
||||
availableRoles []*libregraph.UnifiedRoleDefinition
|
||||
}
|
||||
|
||||
func (g BaseGraphService) getSpaceRootPermissions(ctx context.Context, spaceID *storageprovider.StorageSpaceId) ([]libregraph.Permission, error) {
|
||||
@@ -86,8 +87,7 @@ func (g BaseGraphService) CS3ReceivedSharesToDriveItems(ctx context.Context, rec
|
||||
return nil, err
|
||||
}
|
||||
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
return cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, availableRoles)
|
||||
return cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, g.availableRoles)
|
||||
}
|
||||
|
||||
func (g BaseGraphService) CS3ReceivedOCMSharesToDriveItems(ctx context.Context, receivedShares []*ocm.ReceivedShare) ([]libregraph.DriveItem, error) {
|
||||
@@ -96,8 +96,7 @@ func (g BaseGraphService) CS3ReceivedOCMSharesToDriveItems(ctx context.Context,
|
||||
return nil, err
|
||||
}
|
||||
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
return cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, availableRoles)
|
||||
return cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, g.availableRoles)
|
||||
}
|
||||
|
||||
func (g BaseGraphService) cs3SpacePermissionsToLibreGraph(ctx context.Context, space *storageprovider.StorageSpace, apiVersion APIVersion) []libregraph.Permission {
|
||||
@@ -196,9 +195,8 @@ func (g BaseGraphService) cs3SpacePermissionsToLibreGraph(ctx context.Context, s
|
||||
p.SetExpirationDateTime(time.Unix(int64(exp.GetSeconds()), int64(exp.GetNanos())))
|
||||
}
|
||||
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
if role := unifiedrole.CS3ResourcePermissionsToRole(
|
||||
availableRoles,
|
||||
g.availableRoles,
|
||||
perm,
|
||||
unifiedrole.UnifiedRoleConditionDrive,
|
||||
false,
|
||||
@@ -601,7 +599,7 @@ func (g BaseGraphService) cs3UserShareToPermission(ctx context.Context, share *c
|
||||
perm.SetCreatedDateTime(cs3TimestampToTime(share.GetCtime()))
|
||||
}
|
||||
role := unifiedrole.CS3ResourcePermissionsToRole(
|
||||
unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...)),
|
||||
g.availableRoles,
|
||||
share.GetPermissions().GetPermissions(),
|
||||
roleCondition,
|
||||
false,
|
||||
@@ -689,9 +687,8 @@ func (g BaseGraphService) cs3OCMShareToPermission(ctx context.Context, share *oc
|
||||
}
|
||||
}
|
||||
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
role := unifiedrole.CS3ResourcePermissionsToRole(
|
||||
availableRoles,
|
||||
g.availableRoles,
|
||||
permissions,
|
||||
roleCondition,
|
||||
true,
|
||||
|
||||
@@ -14,7 +14,7 @@ import (
|
||||
// GetRoleDefinitions a list of permission roles than can be used when sharing with users or groups
|
||||
func (g Graph) GetRoleDefinitions(w http.ResponseWriter, r *http.Request) {
|
||||
render.Status(r, http.StatusOK)
|
||||
render.JSON(w, r, unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...)))
|
||||
render.JSON(w, r, g.availableRoles)
|
||||
}
|
||||
|
||||
// GetRoleDefinition a permission role than can be used when sharing with users or groups
|
||||
|
||||
@@ -31,6 +31,7 @@ import (
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/identity"
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/identity/ldap"
|
||||
graphm "github.com/opencloud-eu/opencloud/services/graph/pkg/middleware"
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/unifiedrole"
|
||||
)
|
||||
|
||||
const (
|
||||
@@ -148,6 +149,7 @@ func NewService(opts ...Option) (Graph, error) { //nolint:maintidx
|
||||
identityCache: identityCache,
|
||||
gatewaySelector: options.GatewaySelector,
|
||||
config: options.Config,
|
||||
availableRoles: unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(options.Config.UnifiedRoles.AvailableRoles...)),
|
||||
},
|
||||
mux: m,
|
||||
specialDriveItemsCache: spacePropertiesCache,
|
||||
|
||||
@@ -10,7 +10,6 @@ import (
|
||||
libregraph "github.com/owncloud/libre-graph-api-go"
|
||||
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/errorcode"
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/unifiedrole"
|
||||
)
|
||||
|
||||
// ListSharedWithMe lists the files shared with the current user.
|
||||
@@ -40,8 +39,7 @@ func (g Graph) listSharedWithMe(ctx context.Context) ([]libregraph.DriveItem, er
|
||||
g.logger.Error().Err(err).Msg("listing shares failed")
|
||||
return nil, err
|
||||
}
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
driveItems, err := cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedSharesResponse.GetShares(), availableRoles)
|
||||
driveItems, err := cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedSharesResponse.GetShares(), g.availableRoles)
|
||||
if err != nil {
|
||||
g.logger.Error().Err(err).Msg("could not convert received shares to drive items")
|
||||
return nil, err
|
||||
@@ -53,7 +51,7 @@ func (g Graph) listSharedWithMe(ctx context.Context) ([]libregraph.DriveItem, er
|
||||
g.logger.Error().Err(err).Msg("listing shares failed")
|
||||
return nil, err
|
||||
}
|
||||
ocmDriveItems, err := cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedOCMSharesResponse.GetShares(), availableRoles)
|
||||
ocmDriveItems, err := cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedOCMSharesResponse.GetShares(), g.availableRoles)
|
||||
if err != nil {
|
||||
g.logger.Error().Err(err).Msg("could not convert received ocm shares to drive items")
|
||||
return nil, err
|
||||
|
||||
@@ -17,15 +17,16 @@ node-generate-prod: assets
|
||||
.PHONY: assets
|
||||
assets: pnpm-build \
|
||||
assets/identifier/static \
|
||||
assets/identifier/static/favicon.ico \
|
||||
assets/identifier/static/favicon.svg \
|
||||
assets/identifier/static/icon-lilac.svg
|
||||
|
||||
assets/identifier/static:
|
||||
mkdir -p assets/identifier/static
|
||||
|
||||
.PHONY: assets/identifier/static/favicon.ico # force overwrite
|
||||
assets/identifier/static/favicon.ico:
|
||||
cp src/images/favicon.ico assets/identifier/static/favicon.ico
|
||||
.PHONY: assets/identifier/static/favicon.svg # force overwrite
|
||||
assets/identifier/static/favicon.svg:
|
||||
cp src/images/favicon.svg assets/identifier/static/favicon.svg
|
||||
rm assets/identifier/static/favicon.ico
|
||||
|
||||
.PHONY: assets/identifier/static/icon-lilac.svg
|
||||
assets/identifier/static/icon-lilac.svg:
|
||||
|
||||
@@ -102,7 +102,7 @@
|
||||
"redux-logger": "^3.0.6",
|
||||
"redux-thunk": "^2.4.2",
|
||||
"render-if": "^0.1.1",
|
||||
"web-vitals": "^3.5.2"
|
||||
"web-vitals": "^4.2.4"
|
||||
},
|
||||
"devDependencies": {
|
||||
"@babel/core": "7.26.10",
|
||||
@@ -125,7 +125,7 @@
|
||||
"eslint-plugin-i18next": "^6.1.1",
|
||||
"eslint-plugin-import": "^2.30.0",
|
||||
"eslint-plugin-jest": "^24.7.0",
|
||||
"eslint-plugin-jsx-a11y": "^6.9.0",
|
||||
"eslint-plugin-jsx-a11y": "^6.10.2",
|
||||
"eslint-plugin-react": "^7.37.2",
|
||||
"eslint-plugin-react-hooks": "^4.6.2",
|
||||
"eslint-plugin-testing-library": "^3.10.2",
|
||||
@@ -148,7 +148,7 @@
|
||||
"resolve-url-loader": "^5.0.0",
|
||||
"sass-loader": "^16.0.4",
|
||||
"source-map-explorer": "^2.5.3",
|
||||
"typescript": "^5.7.3",
|
||||
"typescript": "^5.8.3",
|
||||
"url-loader": "4.1.1",
|
||||
"webpack": "5.96.1",
|
||||
"webpack-manifest-plugin": "5.0.0",
|
||||
|
||||
1207
services/idp/pnpm-lock.yaml
generated
1207
services/idp/pnpm-lock.yaml
generated
File diff suppressed because it is too large
Load Diff
@@ -4,7 +4,7 @@
|
||||
<meta charset="utf-8">
|
||||
<meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no">
|
||||
<meta name="theme-color" content="#1b223d">
|
||||
<link rel="shortcut icon" href="%PUBLIC_URL%/static/favicon.ico" type="image/x-icon">
|
||||
<link rel="icon" href="%PUBLIC_URL%/static/favicon.svg" type="image/svg+xml">
|
||||
<meta property="csp-nonce" content="__CSP_NONCE__">
|
||||
<title>Sign in - OpenCloud</title>
|
||||
</head>
|
||||
|
||||
Binary file not shown.
|
Before Width: | Height: | Size: 15 KiB |
3
services/idp/src/images/favicon.svg
Normal file
3
services/idp/src/images/favicon.svg
Normal file
@@ -0,0 +1,3 @@
|
||||
<svg xmlns="http://www.w3.org/2000/svg" version="1.1" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:svgjs="http://svgjs.dev/svgjs" width="512" height="512"><svg id="SvgjsSvg1001" xmlns="http://www.w3.org/2000/svg" width="512" height="512" viewBox="0 0 512 512"><rect x=".02" y="0" width="512" height="512" fill="#20434f"></rect><polygon points="255.98 342.75 271.89 333.57 271.89 267.12 329.08 234.1 329.08 215.78 313.18 206.6 255.6 239.84 198.83 207.06 182.93 216.24 182.93 234.56 240.12 267.58 240.12 333.59 255.98 342.75" fill="#e2baff"></polygon><polygon points="401.95 150.82 256 66.56 256 66.56 256 66.56 110.05 150.82 110.05 187.5 256 103.24 401.95 187.5 401.95 150.82" fill="#e2baff"></polygon><polygon points="401.95 324.5 256 408.76 110.06 324.5 110.06 361.17 256 445.43 256 445.43 256 445.43 401.95 361.17 401.95 324.5" fill="#e2baff"></polygon></svg><style>@media (prefers-color-scheme: light) { :root { filter: none; } }
|
||||
@media (prefers-color-scheme: dark) { :root { filter: none; } }
|
||||
</style></svg>
|
||||
|
After Width: | Height: | Size: 1015 B |
@@ -77,6 +77,7 @@ func Server(cfg *config.Config) *cli.Command {
|
||||
ocdav.Product(cfg.Status.Product),
|
||||
ocdav.Version(cfg.Status.Version),
|
||||
ocdav.VersionString(cfg.Status.VersionString),
|
||||
ocdav.Edition(cfg.Status.Edition),
|
||||
ocdav.MachineAuthAPIKey(cfg.MachineAuthAPIKey),
|
||||
ocdav.Broker(broker.NoOp{}),
|
||||
// ocdav.FavoriteManager() // FIXME needs a proper persistence implementation https://github.com/owncloud/ocis/issues/1228
|
||||
|
||||
@@ -81,4 +81,5 @@ type Status struct {
|
||||
Product string
|
||||
ProductName string
|
||||
ProductVersion string
|
||||
Edition string `yaml:"edition" env:"OC_EDITION;OCDAV_EDITION" desc:"Edition of OpenCloud. Used for branding purposes." introductionVersion:"1.0.0"`
|
||||
}
|
||||
|
||||
@@ -92,6 +92,7 @@ func DefaultConfig() *config.Config {
|
||||
ProductVersion: version.GetString(),
|
||||
Product: "OpenCloud",
|
||||
ProductName: "OpenCloud",
|
||||
Edition: "",
|
||||
},
|
||||
}
|
||||
}
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -108,7 +108,7 @@ func ListUploadSessions(cfg *config.Config) *cli.Command {
|
||||
var fsStream events.Stream
|
||||
if cfg.Driver == "posix" {
|
||||
// We need to init the posix driver with 'scanfs' disabled
|
||||
drivers["posix"] = revaconfig.Posix(cfg, false)
|
||||
drivers["posix"] = revaconfig.Posix(cfg, false, false)
|
||||
// Also posix refuses to start without an events stream
|
||||
fsStream, err = event.NewStream(cfg)
|
||||
if err != nil {
|
||||
|
||||
@@ -85,7 +85,7 @@ func Local(cfg *config.Config) map[string]interface{} {
|
||||
}
|
||||
|
||||
// Posix is the config mapping for the Posix storage driver
|
||||
func Posix(cfg *config.Config, enableFSScan bool) map[string]interface{} {
|
||||
func Posix(cfg *config.Config, enableFSScan, enableFSWatch bool) map[string]interface{} {
|
||||
return map[string]interface{}{
|
||||
"root": cfg.Drivers.Posix.Root,
|
||||
"personalspacepath_template": cfg.Drivers.Posix.PersonalSpacePathTemplate,
|
||||
@@ -137,7 +137,7 @@ func Posix(cfg *config.Config, enableFSScan bool) map[string]interface{} {
|
||||
"use_space_groups": cfg.Drivers.Posix.UseSpaceGroups,
|
||||
"enable_fs_revisions": cfg.Drivers.Posix.EnableFSRevisions,
|
||||
"scan_fs": enableFSScan,
|
||||
"watch_fs": cfg.Drivers.Posix.WatchFS,
|
||||
"watch_fs": enableFSWatch,
|
||||
"watch_type": cfg.Drivers.Posix.WatchType,
|
||||
"watch_path": cfg.Drivers.Posix.WatchPath,
|
||||
"watch_folder_kafka_brokers": cfg.Drivers.Posix.WatchFolderKafkaBrokers,
|
||||
|
||||
@@ -16,7 +16,7 @@ func StorageProviderDrivers(cfg *config.Config) map[string]interface{} {
|
||||
"decomposed": DecomposedNoEvents(cfg),
|
||||
"s3": S3(cfg),
|
||||
"decomposeds3": DecomposedS3NoEvents(cfg),
|
||||
"posix": Posix(cfg, true),
|
||||
"posix": Posix(cfg, true, cfg.Drivers.Posix.WatchFS),
|
||||
|
||||
"ocis": Decomposed(cfg), // deprecated: use decomposed
|
||||
"s3ng": DecomposedS3NoEvents(cfg), // deprecated: use decomposeds3
|
||||
@@ -36,7 +36,7 @@ func DataProviderDrivers(cfg *config.Config) map[string]interface{} {
|
||||
"decomposed": Decomposed(cfg),
|
||||
"s3": S3(cfg),
|
||||
"decomposeds3": DecomposedS3(cfg),
|
||||
"posix": Posix(cfg, false),
|
||||
"posix": Posix(cfg, false, false),
|
||||
|
||||
"ocis": Decomposed(cfg), // deprecated: use decomposed
|
||||
"s3ng": DecomposedS3NoEvents(cfg), // deprecated: use decomposeds3
|
||||
|
||||
@@ -1,6 +1,6 @@
|
||||
SHELL := bash
|
||||
NAME := web
|
||||
WEB_ASSETS_VERSION = v2.1.0
|
||||
WEB_ASSETS_VERSION = v2.2.0
|
||||
WEB_ASSETS_BRANCH = main
|
||||
|
||||
ifneq (, $(shell command -v go 2> /dev/null)) # suppress `command not found warnings` for non go targets in CI
|
||||
|
||||
Binary file not shown.
|
Before Width: | Height: | Size: 15 KiB |
@@ -0,0 +1,3 @@
|
||||
<svg xmlns="http://www.w3.org/2000/svg" version="1.1" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:svgjs="http://svgjs.dev/svgjs" width="512" height="512"><svg id="SvgjsSvg1001" xmlns="http://www.w3.org/2000/svg" width="512" height="512" viewBox="0 0 512 512"><rect x=".02" y="0" width="512" height="512" fill="#20434f"></rect><polygon points="255.98 342.75 271.89 333.57 271.89 267.12 329.08 234.1 329.08 215.78 313.18 206.6 255.6 239.84 198.83 207.06 182.93 216.24 182.93 234.56 240.12 267.58 240.12 333.59 255.98 342.75" fill="#e2baff"></polygon><polygon points="401.95 150.82 256 66.56 256 66.56 256 66.56 110.05 150.82 110.05 187.5 256 103.24 401.95 187.5 401.95 150.82" fill="#e2baff"></polygon><polygon points="401.95 324.5 256 408.76 110.06 324.5 110.06 361.17 256 445.43 256 445.43 256 445.43 401.95 361.17 401.95 324.5" fill="#e2baff"></polygon></svg><style>@media (prefers-color-scheme: light) { :root { filter: none; } }
|
||||
@media (prefers-color-scheme: dark) { :root { filter: none; } }
|
||||
</style></svg>
|
||||
|
After Width: | Height: | Size: 1015 B |
@@ -43,7 +43,7 @@
|
||||
}
|
||||
},
|
||||
"logo": "themes/opencloud-dev/assets/logo.svg",
|
||||
"favicon": "themes/opencloud-dev/assets/favicon.jpg"
|
||||
"favicon": "themes/opencloud-dev/assets/favicon.svg"
|
||||
},
|
||||
"themes": [
|
||||
{
|
||||
|
||||
Binary file not shown.
|
Before Width: | Height: | Size: 15 KiB |
3
services/web/assets/themes/opencloud/assets/favicon.svg
Normal file
3
services/web/assets/themes/opencloud/assets/favicon.svg
Normal file
@@ -0,0 +1,3 @@
|
||||
<svg xmlns="http://www.w3.org/2000/svg" version="1.1" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:svgjs="http://svgjs.dev/svgjs" width="512" height="512"><svg id="SvgjsSvg1001" xmlns="http://www.w3.org/2000/svg" width="512" height="512" viewBox="0 0 512 512"><rect x=".02" y="0" width="512" height="512" fill="#20434f"></rect><polygon points="255.98 342.75 271.89 333.57 271.89 267.12 329.08 234.1 329.08 215.78 313.18 206.6 255.6 239.84 198.83 207.06 182.93 216.24 182.93 234.56 240.12 267.58 240.12 333.59 255.98 342.75" fill="#e2baff"></polygon><polygon points="401.95 150.82 256 66.56 256 66.56 256 66.56 110.05 150.82 110.05 187.5 256 103.24 401.95 187.5 401.95 150.82" fill="#e2baff"></polygon><polygon points="401.95 324.5 256 408.76 110.06 324.5 110.06 361.17 256 445.43 256 445.43 256 445.43 401.95 361.17 401.95 324.5" fill="#e2baff"></polygon></svg><style>@media (prefers-color-scheme: light) { :root { filter: none; } }
|
||||
@media (prefers-color-scheme: dark) { :root { filter: none; } }
|
||||
</style></svg>
|
||||
|
After Width: | Height: | Size: 1015 B |
@@ -50,7 +50,7 @@
|
||||
"web": {
|
||||
"defaults": {
|
||||
"logo": "themes/opencloud/assets/logo.svg",
|
||||
"favicon": "themes/opencloud/assets/favicon.ico",
|
||||
"favicon": "themes/opencloud/assets/favicon.svg",
|
||||
"designTokens": {
|
||||
"breakpoints": {
|
||||
"xsmall-max": "",
|
||||
@@ -94,9 +94,9 @@
|
||||
"label": "Light Theme",
|
||||
"designTokens": {
|
||||
"roles": {
|
||||
"primary": "#07677F",
|
||||
"primary": "#E2BAFF",
|
||||
"surfaceTint": "#07677F",
|
||||
"onPrimary": "#FFFFFF",
|
||||
"onPrimary": "#19353F",
|
||||
"primaryContainer": "#B7EAFF",
|
||||
"onPrimaryContainer": "#001F28",
|
||||
"secondary": "#20434f",
|
||||
@@ -147,17 +147,6 @@
|
||||
"onChrome": "#ffffff"
|
||||
},
|
||||
"colorPalette": {
|
||||
"background-accentuate": "rgba(255, 255, 5, 0.1)",
|
||||
"background-default": "#ffffff",
|
||||
"background-highlight": "#f1f3f4",
|
||||
"background-hover": "#f4e5ff",
|
||||
"background-muted": "#f8f8f8",
|
||||
"background-secondary": "#ffffff",
|
||||
"background-chrome": "#20434F",
|
||||
"background-sidebar": "#F1F3F4",
|
||||
"border": "#ecebee",
|
||||
"color-components-apptopbar-background": "transparent",
|
||||
"color-components-apptopbar-border": "#ceddee",
|
||||
"icon-archive": "#fbbe54",
|
||||
"icon-audio": "#700460",
|
||||
"icon-document": "#3b44a6",
|
||||
@@ -167,46 +156,7 @@
|
||||
"icon-pdf": "#ec0d47",
|
||||
"icon-presentation": "#ee6b3b",
|
||||
"icon-spreadsheet": "#15c286",
|
||||
"icon-video": "#045459",
|
||||
"input-bg": "#ffffff",
|
||||
"input-border": "#396676",
|
||||
"input-text-default": "#19353f",
|
||||
"input-text-muted": "#20434f",
|
||||
"swatch-brand-contrast": "#19353f",
|
||||
"swatch-brand-default": "#E2BAFF",
|
||||
"swatch-brand-hover": "#f4e5ff",
|
||||
"swatch-brand-muted": "#CA8DF5",
|
||||
"swatch-primary-contrast": "#ffffff",
|
||||
"swatch-primary-default": "#20434f",
|
||||
"swatch-primary-gradient": "#20434f",
|
||||
"swatch-primary-gradient-hover": "#20434f",
|
||||
"swatch-primary-hover": "#20434f",
|
||||
"swatch-primary-muted": "#20434f",
|
||||
"swatch-primary-muted-hover": "#20434f",
|
||||
"swatch-passive-contrast": "#ffffff",
|
||||
"swatch-passive-default": "#19353f",
|
||||
"swatch-passive-hover": "#19353f",
|
||||
"swatch-passive-hover-outline": "#ffffff",
|
||||
"swatch-passive-muted": "#19353f",
|
||||
"swatch-inverse-contrast": "#19353f",
|
||||
"swatch-inverse-default": "#ffffff",
|
||||
"swatch-inverse-hover": "#ffffff",
|
||||
"swatch-inverse-muted": "#dadada",
|
||||
"swatch-danger-contrast": "#ffffff",
|
||||
"swatch-danger-default": "#ba1a1a",
|
||||
"swatch-danger-hover": "#b12b2b",
|
||||
"swatch-danger-muted": "rgb(204, 117, 117)",
|
||||
"swatch-success-contrast": "#ffffff",
|
||||
"swatch-success-default": "rgb(3, 84, 63)",
|
||||
"swatch-success-hover": "#023b2c",
|
||||
"swatch-success-muted": "rgb(83, 150, 10)",
|
||||
"swatch-warning-contrast": "#ffffff",
|
||||
"swatch-warning-default": "rgb(183, 76, 27)",
|
||||
"swatch-warning-hover": "#a04318",
|
||||
"swatch-warning-muted": "rgba(183, 76, 27, .5)",
|
||||
"text-default": "#19353f",
|
||||
"text-inverse": "#ffffff",
|
||||
"text-muted": "#19353f"
|
||||
"icon-video": "#045459"
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
@@ -466,7 +466,7 @@ ANTIVIRUS_SCANNER_TYPE="clamav" \
|
||||
ANTIVIRUS_CLAMAV_SOCKET="tcp://host.docker.internal:3310" \
|
||||
POSTPROCESSING_STEPS="virusscan" \
|
||||
OC_ASYNC_UPLOADS=true \
|
||||
OC_ADD_RUN_SERVICES="antivirus"
|
||||
OC_ADD_RUN_SERVICES="antivirus" \
|
||||
opencloud/bin/opencloud server
|
||||
```
|
||||
|
||||
@@ -474,7 +474,7 @@ Note:
|
||||
The value for `ANTIVIRUS_CLAMAV_SOCKET` is an example which needs adaption according your OS.
|
||||
|
||||
For antivirus running localy on Linux OS, use `ANTIVIRUS_CLAMAV_SOCKET= "/var/run/clamav/clamd.ctl"`.
|
||||
For antivirus running localy on Mac OS, use `ANTIVIRUS_CLAMAV_SOCKET= "/tmp/clamd.socket"`.
|
||||
For antivirus running localy on Mac OS, use `ANTIVIRUS_CLAMAV_SOCKET= "/tmp/clamd.sock"`.
|
||||
For antivirus running with docker, use `ANTIVIRUS_CLAMAV_SOCKET= "tcp://host.docker.internal:3310"`
|
||||
|
||||
#### Run the Acceptance Test
|
||||
@@ -576,7 +576,7 @@ make -C opencloud dev-docker
|
||||
```
|
||||
|
||||
### Choose STORAGE_DRIVER
|
||||
By default, the system uses `decomposed` storage. However, you can override this by setting the `STORAGE_DRIVER` environment variable.
|
||||
By default, the system uses `posix` storage. However, you can override this by setting the `STORAGE_DRIVER` environment variable.
|
||||
|
||||
|
||||
### Run a script that starts the openCloud server in the docker and runs the API tests locally (for debugging purposes)
|
||||
|
||||
@@ -214,6 +214,11 @@ class CapabilitiesContext implements Context {
|
||||
$this->featureContext->theHTTPStatusCodeShouldBe(200, '', $response);
|
||||
|
||||
$responseXmlObject = HttpRequestHelper::getResponseXml($response, __METHOD__)->data->capabilities;
|
||||
$edition = $this->getParameterValueFromXml(
|
||||
$responseXmlObject,
|
||||
'core',
|
||||
'status@@@edition'
|
||||
);
|
||||
|
||||
$product = $this->getParameterValueFromXml(
|
||||
$responseXmlObject,
|
||||
@@ -238,6 +243,7 @@ class CapabilitiesContext implements Context {
|
||||
);
|
||||
}
|
||||
|
||||
$jsonExpectedDecoded['edition'] = $edition;
|
||||
$jsonExpectedDecoded['product'] = $product;
|
||||
$jsonExpectedDecoded['productname'] = $productName;
|
||||
|
||||
|
||||
@@ -2042,6 +2042,17 @@ class FeatureContext extends BehatVariablesContext {
|
||||
);
|
||||
}
|
||||
|
||||
/**
|
||||
* @return string
|
||||
*/
|
||||
public function getEditionFromStatus(): string {
|
||||
$decodedResponse = $this->getJsonDecodedStatusPhp();
|
||||
if (isset($decodedResponse['edition'])) {
|
||||
return $decodedResponse['edition'];
|
||||
}
|
||||
return '';
|
||||
}
|
||||
|
||||
/**
|
||||
* @return string|null
|
||||
*/
|
||||
@@ -2271,6 +2282,14 @@ class FeatureContext extends BehatVariablesContext {
|
||||
],
|
||||
"parameter" => []
|
||||
],
|
||||
[
|
||||
"code" => "%edition%",
|
||||
"function" => [
|
||||
$this,
|
||||
"getEditionFromStatus"
|
||||
],
|
||||
"parameter" => []
|
||||
],
|
||||
[
|
||||
"code" => "%version%",
|
||||
"function" => [
|
||||
|
||||
@@ -193,7 +193,6 @@
|
||||
- [apiServiceAvailability/serviceAvailabilityCheck.feature:125](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiServiceAvailability/serviceAvailabilityCheck.feature#L125)
|
||||
|
||||
#### [Skip tests for different languages](https://github.com/opencloud-eu/opencloud/issues/183)
|
||||
- [apiAntivirus/antivirus.feature:311](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiAntivirus/antivirus.feature#L311)
|
||||
- [apiActivities/activities.feature:2598](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiActivities/activities.feature#L2598)
|
||||
|
||||
|
||||
|
||||
@@ -308,7 +308,7 @@ Feature: antivirus
|
||||
| dav-path-version | language | subject | message |
|
||||
| old | es | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Virus: Eicar-Signature |
|
||||
| new | es | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Virus: Eicar-Signature |
|
||||
| spaces | es | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Eicar-Signature |
|
||||
| spaces | es | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Virus: Eicar-Signature |
|
||||
| old | de | Virus gefunden | In aFileWithVirus.txt wurde potenziell schädlicher Code gefunden. Das Hochladen wurde abgebrochen. Grund: Eicar-Signature |
|
||||
| new | de | Virus gefunden | In aFileWithVirus.txt wurde potenziell schädlicher Code gefunden. Das Hochladen wurde abgebrochen. Grund: Eicar-Signature |
|
||||
| spaces | de | Virus gefunden | In aFileWithVirus.txt wurde potenziell schädlicher Code gefunden. Das Hochladen wurde abgebrochen. Grund: Eicar-Signature |
|
||||
|
||||
@@ -193,12 +193,17 @@ Feature: capabilities
|
||||
"status": {
|
||||
"type": "object",
|
||||
"required": [
|
||||
"edition",
|
||||
"product",
|
||||
"productname",
|
||||
"version",
|
||||
"versionstring"
|
||||
],
|
||||
"properties": {
|
||||
"edition": {
|
||||
"type": "string",
|
||||
"enum": ["%edition%"]
|
||||
},
|
||||
"product": {
|
||||
"type": "string",
|
||||
"enum": ["%productname%"]
|
||||
@@ -225,6 +230,7 @@ Feature: capabilities
|
||||
"type": "object",
|
||||
"required": [
|
||||
"string",
|
||||
"edition",
|
||||
"product"
|
||||
],
|
||||
"properties": {
|
||||
@@ -232,6 +238,10 @@ Feature: capabilities
|
||||
"type": "string",
|
||||
"enum": ["%versionstring%"]
|
||||
},
|
||||
"edition": {
|
||||
"type": "string",
|
||||
"enum": ["%edition%"]
|
||||
},
|
||||
"product": {
|
||||
"type": "string",
|
||||
"enum": ["%productname%"]
|
||||
|
||||
@@ -47,6 +47,7 @@ Feature: default capabilities for normal user
|
||||
"required": [
|
||||
"version",
|
||||
"versionstring",
|
||||
"edition",
|
||||
"productname"
|
||||
],
|
||||
"properties": {
|
||||
@@ -56,6 +57,9 @@ Feature: default capabilities for normal user
|
||||
"versionstring": {
|
||||
"const": "%versionstring%"
|
||||
},
|
||||
"edition": {
|
||||
"const": "%edition%"
|
||||
},
|
||||
"productname": {
|
||||
"const": "%productname%"
|
||||
}
|
||||
|
||||
@@ -8,5 +8,5 @@ Feature: Status
|
||||
When the administrator requests status.php
|
||||
Then the status.php response should include
|
||||
"""
|
||||
{"installed":true,"maintenance":false,"needsDbUpgrade":false,"version":"$CURRENT_VERSION","versionstring":"$CURRENT_VERSION_STRING","productname":"$PRODUCTNAME","product":"$PRODUCT"}
|
||||
{"installed":true,"maintenance":false,"needsDbUpgrade":false,"version":"$CURRENT_VERSION","versionstring":"$CURRENT_VERSION_STRING","edition":"$EDITION","productname":"$PRODUCTNAME","product":"$PRODUCT"}
|
||||
"""
|
||||
|
||||
@@ -4,7 +4,7 @@
|
||||
export LOCAL_TEST=true
|
||||
export START_EMAIL=true
|
||||
export WITH_WRAPPER=true
|
||||
export STORAGE_DRIVER=${STORAGE_DRIVER:-decomposed}
|
||||
export STORAGE_DRIVER=${STORAGE_DRIVER:-posix}
|
||||
export TEST_ROOT_PATH="/drone/src/tests"
|
||||
|
||||
# LOCAL TEST WITHOUT EXTRA ENVS
|
||||
|
||||
@@ -7,15 +7,13 @@
|
||||
|
||||
ROOT_PATH="$1"
|
||||
if [ -z "$1" ]; then
|
||||
ROOT_PATH="/drone/src"
|
||||
ROOT_PATH="/woodpecker/src/github.com/opencloud-eu/opencloud"
|
||||
fi
|
||||
BINGO_DIR="$ROOT_PATH/.bingo"
|
||||
|
||||
# generate hash of a .bingo folder
|
||||
BINGO_HASH=$(cat "$BINGO_DIR"/* | sha256sum | cut -d ' ' -f 1)
|
||||
|
||||
URL="$CACHE_ENDPOINT/$CACHE_BUCKET/opencloud/go-bin/$BINGO_HASH/$2"
|
||||
|
||||
mc alias set s3 "$MC_HOST" "$AWS_ACCESS_KEY_ID" "$AWS_SECRET_ACCESS_KEY"
|
||||
|
||||
if mc ls --json s3/"$CACHE_BUCKET"/opencloud/go-bin/"$BINGO_HASH"/$2 | grep "\"status\":\"success\""; then
|
||||
|
||||
102
vendor/github.com/go-playground/validator/v10/.golangci.yaml
generated
vendored
Normal file
102
vendor/github.com/go-playground/validator/v10/.golangci.yaml
generated
vendored
Normal file
@@ -0,0 +1,102 @@
|
||||
version: "2"
|
||||
linters:
|
||||
default: all
|
||||
disable:
|
||||
- asasalint
|
||||
- asciicheck
|
||||
- bidichk
|
||||
- bodyclose
|
||||
- canonicalheader
|
||||
- containedctx
|
||||
- contextcheck
|
||||
- copyloopvar
|
||||
- cyclop
|
||||
- decorder
|
||||
- depguard
|
||||
- dogsled
|
||||
- dupl
|
||||
- dupword
|
||||
- durationcheck
|
||||
- err113
|
||||
- errcheck
|
||||
- errchkjson
|
||||
- errname
|
||||
- errorlint
|
||||
- exhaustive
|
||||
- exhaustruct
|
||||
- exptostd
|
||||
- fatcontext
|
||||
- forbidigo
|
||||
- forcetypeassert
|
||||
- funlen
|
||||
- ginkgolinter
|
||||
- gocheckcompilerdirectives
|
||||
- gochecknoglobals
|
||||
- gochecknoinits
|
||||
- gochecksumtype
|
||||
- gocognit
|
||||
- goconst
|
||||
- gocritic
|
||||
- gocyclo
|
||||
- godot
|
||||
- godox
|
||||
- goheader
|
||||
- gomoddirectives
|
||||
- gomodguard
|
||||
- goprintffuncname
|
||||
- gosec
|
||||
- gosmopolitan
|
||||
- govet
|
||||
- grouper
|
||||
- iface
|
||||
- importas
|
||||
- inamedparam
|
||||
- ineffassign
|
||||
- interfacebloat
|
||||
- intrange
|
||||
- ireturn
|
||||
- lll
|
||||
- loggercheck
|
||||
- maintidx
|
||||
- makezero
|
||||
- mirror
|
||||
- misspell
|
||||
- mnd
|
||||
- musttag
|
||||
- nakedret
|
||||
- nestif
|
||||
- nilerr
|
||||
- nilnesserr
|
||||
- nilnil
|
||||
- nlreturn
|
||||
- noctx
|
||||
- nolintlint
|
||||
- nonamedreturns
|
||||
- nosprintfhostport
|
||||
- paralleltest
|
||||
- perfsprint
|
||||
- prealloc
|
||||
- predeclared
|
||||
- promlinter
|
||||
- protogetter
|
||||
- reassign
|
||||
- recvcheck
|
||||
- revive
|
||||
- rowserrcheck
|
||||
- sloglint
|
||||
- spancheck
|
||||
- sqlclosecheck
|
||||
- staticcheck
|
||||
- tagalign
|
||||
- tagliatelle
|
||||
- testableexamples
|
||||
- testifylint
|
||||
- testpackage
|
||||
- thelper
|
||||
- tparallel
|
||||
- unparam
|
||||
- varnamelen
|
||||
- whitespace
|
||||
- wrapcheck
|
||||
- wsl
|
||||
- zerologlint
|
||||
2
vendor/github.com/go-playground/validator/v10/Makefile
generated
vendored
2
vendor/github.com/go-playground/validator/v10/Makefile
generated
vendored
@@ -3,7 +3,7 @@ GOCMD=go
|
||||
linters-install:
|
||||
@golangci-lint --version >/dev/null 2>&1 || { \
|
||||
echo "installing linting tools..."; \
|
||||
curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v1.41.1; \
|
||||
curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v2.0.2; \
|
||||
}
|
||||
|
||||
lint: linters-install
|
||||
|
||||
4
vendor/github.com/go-playground/validator/v10/README.md
generated
vendored
4
vendor/github.com/go-playground/validator/v10/README.md
generated
vendored
@@ -1,7 +1,6 @@
|
||||
Package validator
|
||||
=================
|
||||
<img align="right" src="logo.png">[](https://gitter.im/go-playground/validator?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge)
|
||||

|
||||
<img align="right" src="logo.png">
|
||||
[](https://github.com/go-playground/validator/actions)
|
||||
[](https://coveralls.io/github/go-playground/validator?branch=master)
|
||||
[](https://goreportcard.com/report/github.com/go-playground/validator)
|
||||
@@ -173,6 +172,7 @@ validate := validator.New(validator.WithRequiredStructEnabled())
|
||||
| spicedb | SpiceDb ObjectID/Permission/Type |
|
||||
| datetime | Datetime |
|
||||
| e164 | e164 formatted phone number |
|
||||
| ein | U.S. Employeer Identification Number |
|
||||
| email | E-mail String
|
||||
| eth_addr | Ethereum Address |
|
||||
| hexadecimal | Hexadecimal String |
|
||||
|
||||
35
vendor/github.com/go-playground/validator/v10/baked_in.go
generated
vendored
35
vendor/github.com/go-playground/validator/v10/baked_in.go
generated
vendored
@@ -9,6 +9,7 @@ import (
|
||||
"fmt"
|
||||
"io/fs"
|
||||
"net"
|
||||
"net/mail"
|
||||
"net/url"
|
||||
"os"
|
||||
"reflect"
|
||||
@@ -242,6 +243,7 @@ var (
|
||||
"mongodb_connection_string": isMongoDBConnectionString,
|
||||
"cron": isCron,
|
||||
"spicedb": isSpiceDB,
|
||||
"ein": isEIN,
|
||||
}
|
||||
)
|
||||
|
||||
@@ -258,7 +260,7 @@ func parseOneOfParam2(s string) []string {
|
||||
oneofValsCacheRWLock.Lock()
|
||||
vals = splitParamsRegex().FindAllString(s, -1)
|
||||
for i := 0; i < len(vals); i++ {
|
||||
vals[i] = strings.Replace(vals[i], "'", "", -1)
|
||||
vals[i] = strings.ReplaceAll(vals[i], "'", "")
|
||||
}
|
||||
oneofValsCache[s] = vals
|
||||
oneofValsCacheRWLock.Unlock()
|
||||
@@ -1376,7 +1378,6 @@ func isEqIgnoreCase(fl FieldLevel) bool {
|
||||
param := fl.Param()
|
||||
|
||||
switch field.Kind() {
|
||||
|
||||
case reflect.String:
|
||||
return strings.EqualFold(field.String(), param)
|
||||
}
|
||||
@@ -1606,7 +1607,6 @@ func isImage(fl FieldLevel) bool {
|
||||
case reflect.String:
|
||||
filePath := field.String()
|
||||
fileInfo, err := os.Stat(filePath)
|
||||
|
||||
if err != nil {
|
||||
return false
|
||||
}
|
||||
@@ -1619,7 +1619,9 @@ func isImage(fl FieldLevel) bool {
|
||||
if err != nil {
|
||||
return false
|
||||
}
|
||||
defer file.Close()
|
||||
defer func() {
|
||||
_ = file.Close()
|
||||
}()
|
||||
|
||||
mime, err := mimetype.DetectReader(file)
|
||||
if err != nil {
|
||||
@@ -1635,7 +1637,6 @@ func isImage(fl FieldLevel) bool {
|
||||
|
||||
// isFilePath is the validation function for validating if the current field's value is a valid file path.
|
||||
func isFilePath(fl FieldLevel) bool {
|
||||
|
||||
var exists bool
|
||||
var err error
|
||||
|
||||
@@ -1695,6 +1696,10 @@ func isE164(fl FieldLevel) bool {
|
||||
|
||||
// isEmail is the validation function for validating if the current field's value is a valid email address.
|
||||
func isEmail(fl FieldLevel) bool {
|
||||
_, err := mail.ParseAddress(fl.Field().String())
|
||||
if err != nil {
|
||||
return false
|
||||
}
|
||||
return emailRegex().MatchString(fl.Field().String())
|
||||
}
|
||||
|
||||
@@ -2227,7 +2232,6 @@ func isGt(fl FieldLevel) bool {
|
||||
case reflect.Struct:
|
||||
|
||||
if field.Type().ConvertibleTo(timeType) {
|
||||
|
||||
return field.Convert(timeType).Interface().(time.Time).After(time.Now().UTC())
|
||||
}
|
||||
}
|
||||
@@ -2464,7 +2468,6 @@ func isLt(fl FieldLevel) bool {
|
||||
case reflect.Struct:
|
||||
|
||||
if field.Type().ConvertibleTo(timeType) {
|
||||
|
||||
return field.Convert(timeType).Interface().(time.Time).Before(time.Now().UTC())
|
||||
}
|
||||
}
|
||||
@@ -2644,7 +2647,6 @@ func isDir(fl FieldLevel) bool {
|
||||
|
||||
// isDirPath is the validation function for validating if the current field's value is a valid directory.
|
||||
func isDirPath(fl FieldLevel) bool {
|
||||
|
||||
var exists bool
|
||||
var err error
|
||||
|
||||
@@ -2957,6 +2959,12 @@ func isCveFormat(fl FieldLevel) bool {
|
||||
// a valid dns RFC 1035 label, defined in RFC 1035.
|
||||
func isDnsRFC1035LabelFormat(fl FieldLevel) bool {
|
||||
val := fl.Field().String()
|
||||
|
||||
size := len(val)
|
||||
if size > 63 {
|
||||
return false
|
||||
}
|
||||
|
||||
return dnsRegexRFC1035Label().MatchString(val)
|
||||
}
|
||||
|
||||
@@ -3060,3 +3068,14 @@ func isCron(fl FieldLevel) bool {
|
||||
cronString := fl.Field().String()
|
||||
return cronRegex().MatchString(cronString)
|
||||
}
|
||||
|
||||
// isEIN is the validation function for validating if the current field's value is a valid U.S. Employer Identification Number (EIN)
|
||||
func isEIN(fl FieldLevel) bool {
|
||||
field := fl.Field()
|
||||
|
||||
if field.Len() != 10 {
|
||||
return false
|
||||
}
|
||||
|
||||
return einRegex().MatchString(field.String())
|
||||
}
|
||||
|
||||
2
vendor/github.com/go-playground/validator/v10/cache.go
generated
vendored
2
vendor/github.com/go-playground/validator/v10/cache.go
generated
vendored
@@ -309,7 +309,7 @@ func (v *Validate) parseFieldTagsRecursive(tag string, fieldName string, alias s
|
||||
}
|
||||
|
||||
if len(vals) > 1 {
|
||||
current.param = strings.Replace(strings.Replace(vals[1], utf8HexComma, ",", -1), utf8Pipe, "|", -1)
|
||||
current.param = strings.ReplaceAll(strings.ReplaceAll(vals[1], utf8HexComma, ","), utf8Pipe, "|")
|
||||
}
|
||||
}
|
||||
current.isBlockEnd = true
|
||||
|
||||
8
vendor/github.com/go-playground/validator/v10/doc.go
generated
vendored
8
vendor/github.com/go-playground/validator/v10/doc.go
generated
vendored
@@ -959,7 +959,7 @@ Although an empty string is a valid base64 URL safe value, this will report
|
||||
an empty string as an error, if you wish to accept an empty string as valid
|
||||
you can use this with the omitempty tag.
|
||||
|
||||
Usage: base64url
|
||||
Usage: base64rawurl
|
||||
|
||||
# Bitcoin Address
|
||||
|
||||
@@ -1134,6 +1134,12 @@ This validates that a string value contains a valid longitude.
|
||||
|
||||
Usage: longitude
|
||||
|
||||
# Employeer Identification Number EIN
|
||||
|
||||
This validates that a string value contains a valid U.S. Employer Identification Number.
|
||||
|
||||
Usage: ein
|
||||
|
||||
# Social Security Number SSN
|
||||
|
||||
This validates that a string value contains a valid U.S. Social Security Number.
|
||||
|
||||
4
vendor/github.com/go-playground/validator/v10/regexes.go
generated
vendored
4
vendor/github.com/go-playground/validator/v10/regexes.go
generated
vendored
@@ -69,7 +69,7 @@ const (
|
||||
splitParamsRegexString = `'[^']*'|\S+`
|
||||
bicRegexString = `^[A-Za-z]{6}[A-Za-z0-9]{2}([A-Za-z0-9]{3})?$`
|
||||
semverRegexString = `^(0|[1-9]\d*)\.(0|[1-9]\d*)\.(0|[1-9]\d*)(?:-((?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*)(?:\.(?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*))*))?(?:\+([0-9a-zA-Z-]+(?:\.[0-9a-zA-Z-]+)*))?$` // numbered capture groups https://semver.org/
|
||||
dnsRegexStringRFC1035Label = "^[a-z]([-a-z0-9]*[a-z0-9]){0,62}$"
|
||||
dnsRegexStringRFC1035Label = "^[a-z]([-a-z0-9]*[a-z0-9])?$"
|
||||
cveRegexString = `^CVE-(1999|2\d{3})-(0[^0]\d{2}|0\d[^0]\d{1}|0\d{2}[^0]|[1-9]{1}\d{3,})$` // CVE Format Id https://cve.mitre.org/cve/identifiers/syntaxchange.html
|
||||
mongodbIdRegexString = "^[a-f\\d]{24}$"
|
||||
mongodbConnStringRegexString = "^mongodb(\\+srv)?:\\/\\/(([a-zA-Z\\d]+):([a-zA-Z\\d$:\\/?#\\[\\]@]+)@)?(([a-z\\d.-]+)(:[\\d]+)?)((,(([a-z\\d.-]+)(:(\\d+))?))*)?(\\/[a-zA-Z-_]{1,64})?(\\?(([a-zA-Z]+)=([a-zA-Z\\d]+))(&(([a-zA-Z\\d]+)=([a-zA-Z\\d]+))?)*)?$"
|
||||
@@ -77,6 +77,7 @@ const (
|
||||
spicedbIDRegexString = `^(([a-zA-Z0-9/_|\-=+]{1,})|\*)$`
|
||||
spicedbPermissionRegexString = "^([a-z][a-z0-9_]{1,62}[a-z0-9])?$"
|
||||
spicedbTypeRegexString = "^([a-z][a-z0-9_]{1,61}[a-z0-9]/)?[a-z][a-z0-9_]{1,62}[a-z0-9]$"
|
||||
einRegexString = "^(\\d{2}-\\d{7})$"
|
||||
)
|
||||
|
||||
func lazyRegexCompile(str string) func() *regexp.Regexp {
|
||||
@@ -160,4 +161,5 @@ var (
|
||||
spicedbIDRegex = lazyRegexCompile(spicedbIDRegexString)
|
||||
spicedbPermissionRegex = lazyRegexCompile(spicedbPermissionRegexString)
|
||||
spicedbTypeRegex = lazyRegexCompile(spicedbTypeRegexString)
|
||||
einRegex = lazyRegexCompile(einRegexString)
|
||||
)
|
||||
|
||||
6
vendor/github.com/go-playground/validator/v10/struct_level.go
generated
vendored
6
vendor/github.com/go-playground/validator/v10/struct_level.go
generated
vendored
@@ -46,9 +46,9 @@ type StructLevel interface {
|
||||
//
|
||||
// NOTES:
|
||||
//
|
||||
// fieldName and altName get appended to the existing namespace that
|
||||
// validator is on. e.g. pass 'FirstName' or 'Names[0]' depending
|
||||
// on the nesting
|
||||
// fieldName and structFieldName get appended to the existing
|
||||
// namespace that validator is on. e.g. pass 'FirstName' or
|
||||
// 'Names[0]' depending on the nesting
|
||||
//
|
||||
// tag can be an existing validation tag or just something you make up
|
||||
// and process on the flip side it's up to you.
|
||||
|
||||
70
vendor/github.com/go-playground/validator/v10/translations/en/en.go
generated
vendored
70
vendor/github.com/go-playground/validator/v10/translations/en/en.go
generated
vendored
@@ -217,17 +217,18 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
customTransFunc: func(ut ut.Translator, fe validator.FieldError) string {
|
||||
var err error
|
||||
var t string
|
||||
|
||||
var f64 float64
|
||||
var digits uint64
|
||||
var kind reflect.Kind
|
||||
|
||||
if idx := strings.Index(fe.Param(), "."); idx != -1 {
|
||||
digits = uint64(len(fe.Param()[idx+1:]))
|
||||
}
|
||||
fn := func() (err error) {
|
||||
if idx := strings.Index(fe.Param(), "."); idx != -1 {
|
||||
digits = uint64(len(fe.Param()[idx+1:]))
|
||||
}
|
||||
|
||||
f64, err := strconv.ParseFloat(fe.Param(), 64)
|
||||
if err != nil {
|
||||
goto END
|
||||
f64, err = strconv.ParseFloat(fe.Param(), 64)
|
||||
|
||||
return
|
||||
}
|
||||
|
||||
kind = fe.Kind()
|
||||
@@ -240,6 +241,11 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
|
||||
var c string
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
c, err = ut.C("min-string-character", f64, digits, ut.FmtNumber(f64, digits))
|
||||
if err != nil {
|
||||
goto END
|
||||
@@ -250,6 +256,11 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
case reflect.Slice, reflect.Map, reflect.Array:
|
||||
var c string
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
c, err = ut.C("min-items-item", f64, digits, ut.FmtNumber(f64, digits))
|
||||
if err != nil {
|
||||
goto END
|
||||
@@ -258,6 +269,16 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
t, err = ut.T("min-items", fe.Field(), c)
|
||||
|
||||
default:
|
||||
if fe.Type() == reflect.TypeOf(time.Duration(0)) {
|
||||
t, err = ut.T("min-number", fe.Field(), fe.Param())
|
||||
goto END
|
||||
}
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
t, err = ut.T("min-number", fe.Field(), ut.FmtNumber(f64, digits))
|
||||
}
|
||||
|
||||
@@ -305,17 +326,18 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
customTransFunc: func(ut ut.Translator, fe validator.FieldError) string {
|
||||
var err error
|
||||
var t string
|
||||
|
||||
var f64 float64
|
||||
var digits uint64
|
||||
var kind reflect.Kind
|
||||
|
||||
if idx := strings.Index(fe.Param(), "."); idx != -1 {
|
||||
digits = uint64(len(fe.Param()[idx+1:]))
|
||||
}
|
||||
fn := func() (err error) {
|
||||
if idx := strings.Index(fe.Param(), "."); idx != -1 {
|
||||
digits = uint64(len(fe.Param()[idx+1:]))
|
||||
}
|
||||
|
||||
f64, err := strconv.ParseFloat(fe.Param(), 64)
|
||||
if err != nil {
|
||||
goto END
|
||||
f64, err = strconv.ParseFloat(fe.Param(), 64)
|
||||
|
||||
return
|
||||
}
|
||||
|
||||
kind = fe.Kind()
|
||||
@@ -328,6 +350,11 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
|
||||
var c string
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
c, err = ut.C("max-string-character", f64, digits, ut.FmtNumber(f64, digits))
|
||||
if err != nil {
|
||||
goto END
|
||||
@@ -338,6 +365,11 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
case reflect.Slice, reflect.Map, reflect.Array:
|
||||
var c string
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
c, err = ut.C("max-items-item", f64, digits, ut.FmtNumber(f64, digits))
|
||||
if err != nil {
|
||||
goto END
|
||||
@@ -346,6 +378,16 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
t, err = ut.T("max-items", fe.Field(), c)
|
||||
|
||||
default:
|
||||
if fe.Type() == reflect.TypeOf(time.Duration(0)) {
|
||||
t, err = ut.T("max-number", fe.Field(), fe.Param())
|
||||
goto END
|
||||
}
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
t, err = ut.T("max-number", fe.Field(), ut.FmtNumber(f64, digits))
|
||||
}
|
||||
|
||||
|
||||
23
vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml
generated
vendored
23
vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml
generated
vendored
@@ -1,5 +1,4 @@
|
||||
# This is an example goreleaser.yaml file with some sane defaults.
|
||||
# Make sure to check the documentation at http://goreleaser.com
|
||||
version: 2
|
||||
|
||||
builds:
|
||||
-
|
||||
@@ -27,16 +26,7 @@ builds:
|
||||
archives:
|
||||
-
|
||||
id: cpuid
|
||||
name_template: "cpuid-{{ .Os }}_{{ .Arch }}_{{ .Version }}"
|
||||
replacements:
|
||||
aix: AIX
|
||||
darwin: OSX
|
||||
linux: Linux
|
||||
windows: Windows
|
||||
386: i386
|
||||
amd64: x86_64
|
||||
freebsd: FreeBSD
|
||||
netbsd: NetBSD
|
||||
name_template: "cpuid-{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
|
||||
format_overrides:
|
||||
- goos: windows
|
||||
format: zip
|
||||
@@ -44,8 +34,6 @@ archives:
|
||||
- LICENSE
|
||||
checksum:
|
||||
name_template: 'checksums.txt'
|
||||
snapshot:
|
||||
name_template: "{{ .Tag }}-next"
|
||||
changelog:
|
||||
sort: asc
|
||||
filters:
|
||||
@@ -58,7 +46,7 @@ changelog:
|
||||
|
||||
nfpms:
|
||||
-
|
||||
file_name_template: "cpuid_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}"
|
||||
file_name_template: "cpuid_package_{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
|
||||
vendor: Klaus Post
|
||||
homepage: https://github.com/klauspost/cpuid
|
||||
maintainer: Klaus Post <klauspost@gmail.com>
|
||||
@@ -67,8 +55,3 @@ nfpms:
|
||||
formats:
|
||||
- deb
|
||||
- rpm
|
||||
replacements:
|
||||
darwin: Darwin
|
||||
linux: Linux
|
||||
freebsd: FreeBSD
|
||||
amd64: x86_64
|
||||
|
||||
6
vendor/github.com/klauspost/cpuid/v2/README.md
generated
vendored
6
vendor/github.com/klauspost/cpuid/v2/README.md
generated
vendored
@@ -282,7 +282,9 @@ Exit Code 1
|
||||
| AMXINT8 | Tile computational operations on 8-bit integers |
|
||||
| AMXFP16 | Tile computational operations on FP16 numbers |
|
||||
| AMXFP8 | Tile computational operations on FP8 numbers |
|
||||
| AMXCOMPLEX | Tile computational operations on complex numbers |
|
||||
| AMXTILE | Tile architecture |
|
||||
| AMXTF32 | Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile |
|
||||
| APX_F | Intel APX |
|
||||
| AVX | AVX functions |
|
||||
| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported |
|
||||
@@ -480,12 +482,16 @@ Exit Code 1
|
||||
| DCPOP | Data cache clean to Point of Persistence (DC CVAP) |
|
||||
| EVTSTRM | Generic timer |
|
||||
| FCMA | Floatin point complex number addition and multiplication |
|
||||
| FHM | FMLAL and FMLSL instructions |
|
||||
| FP | Single-precision and double-precision floating point |
|
||||
| FPHP | Half-precision floating point |
|
||||
| GPA | Generic Pointer Authentication |
|
||||
| JSCVT | Javascript-style double->int convert (FJCVTZS) |
|
||||
| LRCPC | Weaker release consistency (LDAPR, etc) |
|
||||
| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) |
|
||||
| RNDR | Random Number instructions |
|
||||
| TLB | Outer Shareable and TLB range maintenance instructions |
|
||||
| TS | Flag manipulation instructions |
|
||||
| SHA1 | SHA-1 instructions (SHA1C, etc) |
|
||||
| SHA2 | SHA-2 instructions (SHA256H, etc) |
|
||||
| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) |
|
||||
|
||||
10
vendor/github.com/klauspost/cpuid/v2/cpuid.go
generated
vendored
10
vendor/github.com/klauspost/cpuid/v2/cpuid.go
generated
vendored
@@ -83,6 +83,8 @@ const (
|
||||
AMXINT8 // Tile computational operations on 8-bit integers
|
||||
AMXFP8 // Tile computational operations on FP8 numbers
|
||||
AMXTILE // Tile architecture
|
||||
AMXTF32 // Tile architecture
|
||||
AMXCOMPLEX // Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile
|
||||
APX_F // Intel APX
|
||||
AVX // AVX functions
|
||||
AVX10 // If set the Intel AVX10 Converged Vector ISA is supported
|
||||
@@ -282,12 +284,16 @@ const (
|
||||
DCPOP // Data cache clean to Point of Persistence (DC CVAP)
|
||||
EVTSTRM // Generic timer
|
||||
FCMA // Floatin point complex number addition and multiplication
|
||||
FHM // FMLAL and FMLSL instructions
|
||||
FP // Single-precision and double-precision floating point
|
||||
FPHP // Half-precision floating point
|
||||
GPA // Generic Pointer Authentication
|
||||
JSCVT // Javascript-style double->int convert (FJCVTZS)
|
||||
LRCPC // Weaker release consistency (LDAPR, etc)
|
||||
PMULL // Polynomial Multiply instructions (PMULL/PMULL2)
|
||||
RNDR // Random Number instructions
|
||||
TLB // Outer Shareable and TLB range maintenance instructions
|
||||
TS // Flag manipulation instructions
|
||||
SHA1 // SHA-1 instructions (SHA1C, etc)
|
||||
SHA2 // SHA-2 instructions (SHA256H, etc)
|
||||
SHA3 // SHA-3 instructions (EOR3, RAXI, XAR, BCAX)
|
||||
@@ -532,7 +538,7 @@ func (c CPUInfo) Ia32TscAux() uint32 {
|
||||
return ecx
|
||||
}
|
||||
|
||||
// SveLengths returns arm SVE vector and predicate lengths.
|
||||
// SveLengths returns arm SVE vector and predicate lengths in bits.
|
||||
// Will return 0, 0 if SVE is not enabled or otherwise unable to detect.
|
||||
func (c CPUInfo) SveLengths() (vl, pl uint64) {
|
||||
if !c.Has(SVE) {
|
||||
@@ -1284,6 +1290,8 @@ func support() flagSet {
|
||||
// CPUID.(EAX=7, ECX=1).EDX
|
||||
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
|
||||
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
|
||||
fs.setIf(edx1&(1<<7) != 0, AMXTF32)
|
||||
fs.setIf(edx1&(1<<8) != 0, AMXCOMPLEX)
|
||||
fs.setIf(edx1&(1<<10) != 0, AVXVNNIINT16)
|
||||
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
|
||||
fs.setIf(edx1&(1<<19) != 0, AVX10)
|
||||
|
||||
14
vendor/github.com/klauspost/cpuid/v2/detect_arm64.go
generated
vendored
14
vendor/github.com/klauspost/cpuid/v2/detect_arm64.go
generated
vendored
@@ -157,6 +157,10 @@ func addInfo(c *CPUInfo, safe bool) {
|
||||
// x--------------------------------------------------x
|
||||
// | Name | bits | visible |
|
||||
// |--------------------------------------------------|
|
||||
// | RNDR | [63-60] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | TLB | [59-56] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | TS | [55-52] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | FHM | [51-48] | y |
|
||||
@@ -182,12 +186,10 @@ func addInfo(c *CPUInfo, safe bool) {
|
||||
// | AES | [7-4] | y |
|
||||
// x--------------------------------------------------x
|
||||
|
||||
// if instAttrReg0&(0xf<<52) != 0 {
|
||||
// fmt.Println("TS")
|
||||
// }
|
||||
// if instAttrReg0&(0xf<<48) != 0 {
|
||||
// fmt.Println("FHM")
|
||||
// }
|
||||
f.setIf(instAttrReg0&(0xf<<60) != 0, RNDR)
|
||||
f.setIf(instAttrReg0&(0xf<<56) != 0, TLB)
|
||||
f.setIf(instAttrReg0&(0xf<<52) != 0, TS)
|
||||
f.setIf(instAttrReg0&(0xf<<48) != 0, FHM)
|
||||
f.setIf(instAttrReg0&(0xf<<44) != 0, ASIMDDP)
|
||||
f.setIf(instAttrReg0&(0xf<<40) != 0, SM4)
|
||||
f.setIf(instAttrReg0&(0xf<<36) != 0, SM3)
|
||||
|
||||
432
vendor/github.com/klauspost/cpuid/v2/featureid_string.go
generated
vendored
432
vendor/github.com/klauspost/cpuid/v2/featureid_string.go
generated
vendored
@@ -17,223 +17,229 @@ func _() {
|
||||
_ = x[AMXINT8-7]
|
||||
_ = x[AMXFP8-8]
|
||||
_ = x[AMXTILE-9]
|
||||
_ = x[APX_F-10]
|
||||
_ = x[AVX-11]
|
||||
_ = x[AVX10-12]
|
||||
_ = x[AVX10_128-13]
|
||||
_ = x[AVX10_256-14]
|
||||
_ = x[AVX10_512-15]
|
||||
_ = x[AVX2-16]
|
||||
_ = x[AVX512BF16-17]
|
||||
_ = x[AVX512BITALG-18]
|
||||
_ = x[AVX512BW-19]
|
||||
_ = x[AVX512CD-20]
|
||||
_ = x[AVX512DQ-21]
|
||||
_ = x[AVX512ER-22]
|
||||
_ = x[AVX512F-23]
|
||||
_ = x[AVX512FP16-24]
|
||||
_ = x[AVX512IFMA-25]
|
||||
_ = x[AVX512PF-26]
|
||||
_ = x[AVX512VBMI-27]
|
||||
_ = x[AVX512VBMI2-28]
|
||||
_ = x[AVX512VL-29]
|
||||
_ = x[AVX512VNNI-30]
|
||||
_ = x[AVX512VP2INTERSECT-31]
|
||||
_ = x[AVX512VPOPCNTDQ-32]
|
||||
_ = x[AVXIFMA-33]
|
||||
_ = x[AVXNECONVERT-34]
|
||||
_ = x[AVXSLOW-35]
|
||||
_ = x[AVXVNNI-36]
|
||||
_ = x[AVXVNNIINT8-37]
|
||||
_ = x[AVXVNNIINT16-38]
|
||||
_ = x[BHI_CTRL-39]
|
||||
_ = x[BMI1-40]
|
||||
_ = x[BMI2-41]
|
||||
_ = x[CETIBT-42]
|
||||
_ = x[CETSS-43]
|
||||
_ = x[CLDEMOTE-44]
|
||||
_ = x[CLMUL-45]
|
||||
_ = x[CLZERO-46]
|
||||
_ = x[CMOV-47]
|
||||
_ = x[CMPCCXADD-48]
|
||||
_ = x[CMPSB_SCADBS_SHORT-49]
|
||||
_ = x[CMPXCHG8-50]
|
||||
_ = x[CPBOOST-51]
|
||||
_ = x[CPPC-52]
|
||||
_ = x[CX16-53]
|
||||
_ = x[EFER_LMSLE_UNS-54]
|
||||
_ = x[ENQCMD-55]
|
||||
_ = x[ERMS-56]
|
||||
_ = x[F16C-57]
|
||||
_ = x[FLUSH_L1D-58]
|
||||
_ = x[FMA3-59]
|
||||
_ = x[FMA4-60]
|
||||
_ = x[FP128-61]
|
||||
_ = x[FP256-62]
|
||||
_ = x[FSRM-63]
|
||||
_ = x[FXSR-64]
|
||||
_ = x[FXSROPT-65]
|
||||
_ = x[GFNI-66]
|
||||
_ = x[HLE-67]
|
||||
_ = x[HRESET-68]
|
||||
_ = x[HTT-69]
|
||||
_ = x[HWA-70]
|
||||
_ = x[HYBRID_CPU-71]
|
||||
_ = x[HYPERVISOR-72]
|
||||
_ = x[IA32_ARCH_CAP-73]
|
||||
_ = x[IA32_CORE_CAP-74]
|
||||
_ = x[IBPB-75]
|
||||
_ = x[IBPB_BRTYPE-76]
|
||||
_ = x[IBRS-77]
|
||||
_ = x[IBRS_PREFERRED-78]
|
||||
_ = x[IBRS_PROVIDES_SMP-79]
|
||||
_ = x[IBS-80]
|
||||
_ = x[IBSBRNTRGT-81]
|
||||
_ = x[IBSFETCHSAM-82]
|
||||
_ = x[IBSFFV-83]
|
||||
_ = x[IBSOPCNT-84]
|
||||
_ = x[IBSOPCNTEXT-85]
|
||||
_ = x[IBSOPSAM-86]
|
||||
_ = x[IBSRDWROPCNT-87]
|
||||
_ = x[IBSRIPINVALIDCHK-88]
|
||||
_ = x[IBS_FETCH_CTLX-89]
|
||||
_ = x[IBS_OPDATA4-90]
|
||||
_ = x[IBS_OPFUSE-91]
|
||||
_ = x[IBS_PREVENTHOST-92]
|
||||
_ = x[IBS_ZEN4-93]
|
||||
_ = x[IDPRED_CTRL-94]
|
||||
_ = x[INT_WBINVD-95]
|
||||
_ = x[INVLPGB-96]
|
||||
_ = x[KEYLOCKER-97]
|
||||
_ = x[KEYLOCKERW-98]
|
||||
_ = x[LAHF-99]
|
||||
_ = x[LAM-100]
|
||||
_ = x[LBRVIRT-101]
|
||||
_ = x[LZCNT-102]
|
||||
_ = x[MCAOVERFLOW-103]
|
||||
_ = x[MCDT_NO-104]
|
||||
_ = x[MCOMMIT-105]
|
||||
_ = x[MD_CLEAR-106]
|
||||
_ = x[MMX-107]
|
||||
_ = x[MMXEXT-108]
|
||||
_ = x[MOVBE-109]
|
||||
_ = x[MOVDIR64B-110]
|
||||
_ = x[MOVDIRI-111]
|
||||
_ = x[MOVSB_ZL-112]
|
||||
_ = x[MOVU-113]
|
||||
_ = x[MPX-114]
|
||||
_ = x[MSRIRC-115]
|
||||
_ = x[MSRLIST-116]
|
||||
_ = x[MSR_PAGEFLUSH-117]
|
||||
_ = x[NRIPS-118]
|
||||
_ = x[NX-119]
|
||||
_ = x[OSXSAVE-120]
|
||||
_ = x[PCONFIG-121]
|
||||
_ = x[POPCNT-122]
|
||||
_ = x[PPIN-123]
|
||||
_ = x[PREFETCHI-124]
|
||||
_ = x[PSFD-125]
|
||||
_ = x[RDPRU-126]
|
||||
_ = x[RDRAND-127]
|
||||
_ = x[RDSEED-128]
|
||||
_ = x[RDTSCP-129]
|
||||
_ = x[RRSBA_CTRL-130]
|
||||
_ = x[RTM-131]
|
||||
_ = x[RTM_ALWAYS_ABORT-132]
|
||||
_ = x[SBPB-133]
|
||||
_ = x[SERIALIZE-134]
|
||||
_ = x[SEV-135]
|
||||
_ = x[SEV_64BIT-136]
|
||||
_ = x[SEV_ALTERNATIVE-137]
|
||||
_ = x[SEV_DEBUGSWAP-138]
|
||||
_ = x[SEV_ES-139]
|
||||
_ = x[SEV_RESTRICTED-140]
|
||||
_ = x[SEV_SNP-141]
|
||||
_ = x[SGX-142]
|
||||
_ = x[SGXLC-143]
|
||||
_ = x[SHA-144]
|
||||
_ = x[SME-145]
|
||||
_ = x[SME_COHERENT-146]
|
||||
_ = x[SPEC_CTRL_SSBD-147]
|
||||
_ = x[SRBDS_CTRL-148]
|
||||
_ = x[SRSO_MSR_FIX-149]
|
||||
_ = x[SRSO_NO-150]
|
||||
_ = x[SRSO_USER_KERNEL_NO-151]
|
||||
_ = x[SSE-152]
|
||||
_ = x[SSE2-153]
|
||||
_ = x[SSE3-154]
|
||||
_ = x[SSE4-155]
|
||||
_ = x[SSE42-156]
|
||||
_ = x[SSE4A-157]
|
||||
_ = x[SSSE3-158]
|
||||
_ = x[STIBP-159]
|
||||
_ = x[STIBP_ALWAYSON-160]
|
||||
_ = x[STOSB_SHORT-161]
|
||||
_ = x[SUCCOR-162]
|
||||
_ = x[SVM-163]
|
||||
_ = x[SVMDA-164]
|
||||
_ = x[SVMFBASID-165]
|
||||
_ = x[SVML-166]
|
||||
_ = x[SVMNP-167]
|
||||
_ = x[SVMPF-168]
|
||||
_ = x[SVMPFT-169]
|
||||
_ = x[SYSCALL-170]
|
||||
_ = x[SYSEE-171]
|
||||
_ = x[TBM-172]
|
||||
_ = x[TDX_GUEST-173]
|
||||
_ = x[TLB_FLUSH_NESTED-174]
|
||||
_ = x[TME-175]
|
||||
_ = x[TOPEXT-176]
|
||||
_ = x[TSCRATEMSR-177]
|
||||
_ = x[TSXLDTRK-178]
|
||||
_ = x[VAES-179]
|
||||
_ = x[VMCBCLEAN-180]
|
||||
_ = x[VMPL-181]
|
||||
_ = x[VMSA_REGPROT-182]
|
||||
_ = x[VMX-183]
|
||||
_ = x[VPCLMULQDQ-184]
|
||||
_ = x[VTE-185]
|
||||
_ = x[WAITPKG-186]
|
||||
_ = x[WBNOINVD-187]
|
||||
_ = x[WRMSRNS-188]
|
||||
_ = x[X87-189]
|
||||
_ = x[XGETBV1-190]
|
||||
_ = x[XOP-191]
|
||||
_ = x[XSAVE-192]
|
||||
_ = x[XSAVEC-193]
|
||||
_ = x[XSAVEOPT-194]
|
||||
_ = x[XSAVES-195]
|
||||
_ = x[AESARM-196]
|
||||
_ = x[ARMCPUID-197]
|
||||
_ = x[ASIMD-198]
|
||||
_ = x[ASIMDDP-199]
|
||||
_ = x[ASIMDHP-200]
|
||||
_ = x[ASIMDRDM-201]
|
||||
_ = x[ATOMICS-202]
|
||||
_ = x[CRC32-203]
|
||||
_ = x[DCPOP-204]
|
||||
_ = x[EVTSTRM-205]
|
||||
_ = x[FCMA-206]
|
||||
_ = x[FP-207]
|
||||
_ = x[FPHP-208]
|
||||
_ = x[GPA-209]
|
||||
_ = x[JSCVT-210]
|
||||
_ = x[LRCPC-211]
|
||||
_ = x[PMULL-212]
|
||||
_ = x[SHA1-213]
|
||||
_ = x[SHA2-214]
|
||||
_ = x[SHA3-215]
|
||||
_ = x[SHA512-216]
|
||||
_ = x[SM3-217]
|
||||
_ = x[SM4-218]
|
||||
_ = x[SVE-219]
|
||||
_ = x[lastID-220]
|
||||
_ = x[AMXTF32-10]
|
||||
_ = x[AMXCOMPLEX-11]
|
||||
_ = x[APX_F-12]
|
||||
_ = x[AVX-13]
|
||||
_ = x[AVX10-14]
|
||||
_ = x[AVX10_128-15]
|
||||
_ = x[AVX10_256-16]
|
||||
_ = x[AVX10_512-17]
|
||||
_ = x[AVX2-18]
|
||||
_ = x[AVX512BF16-19]
|
||||
_ = x[AVX512BITALG-20]
|
||||
_ = x[AVX512BW-21]
|
||||
_ = x[AVX512CD-22]
|
||||
_ = x[AVX512DQ-23]
|
||||
_ = x[AVX512ER-24]
|
||||
_ = x[AVX512F-25]
|
||||
_ = x[AVX512FP16-26]
|
||||
_ = x[AVX512IFMA-27]
|
||||
_ = x[AVX512PF-28]
|
||||
_ = x[AVX512VBMI-29]
|
||||
_ = x[AVX512VBMI2-30]
|
||||
_ = x[AVX512VL-31]
|
||||
_ = x[AVX512VNNI-32]
|
||||
_ = x[AVX512VP2INTERSECT-33]
|
||||
_ = x[AVX512VPOPCNTDQ-34]
|
||||
_ = x[AVXIFMA-35]
|
||||
_ = x[AVXNECONVERT-36]
|
||||
_ = x[AVXSLOW-37]
|
||||
_ = x[AVXVNNI-38]
|
||||
_ = x[AVXVNNIINT8-39]
|
||||
_ = x[AVXVNNIINT16-40]
|
||||
_ = x[BHI_CTRL-41]
|
||||
_ = x[BMI1-42]
|
||||
_ = x[BMI2-43]
|
||||
_ = x[CETIBT-44]
|
||||
_ = x[CETSS-45]
|
||||
_ = x[CLDEMOTE-46]
|
||||
_ = x[CLMUL-47]
|
||||
_ = x[CLZERO-48]
|
||||
_ = x[CMOV-49]
|
||||
_ = x[CMPCCXADD-50]
|
||||
_ = x[CMPSB_SCADBS_SHORT-51]
|
||||
_ = x[CMPXCHG8-52]
|
||||
_ = x[CPBOOST-53]
|
||||
_ = x[CPPC-54]
|
||||
_ = x[CX16-55]
|
||||
_ = x[EFER_LMSLE_UNS-56]
|
||||
_ = x[ENQCMD-57]
|
||||
_ = x[ERMS-58]
|
||||
_ = x[F16C-59]
|
||||
_ = x[FLUSH_L1D-60]
|
||||
_ = x[FMA3-61]
|
||||
_ = x[FMA4-62]
|
||||
_ = x[FP128-63]
|
||||
_ = x[FP256-64]
|
||||
_ = x[FSRM-65]
|
||||
_ = x[FXSR-66]
|
||||
_ = x[FXSROPT-67]
|
||||
_ = x[GFNI-68]
|
||||
_ = x[HLE-69]
|
||||
_ = x[HRESET-70]
|
||||
_ = x[HTT-71]
|
||||
_ = x[HWA-72]
|
||||
_ = x[HYBRID_CPU-73]
|
||||
_ = x[HYPERVISOR-74]
|
||||
_ = x[IA32_ARCH_CAP-75]
|
||||
_ = x[IA32_CORE_CAP-76]
|
||||
_ = x[IBPB-77]
|
||||
_ = x[IBPB_BRTYPE-78]
|
||||
_ = x[IBRS-79]
|
||||
_ = x[IBRS_PREFERRED-80]
|
||||
_ = x[IBRS_PROVIDES_SMP-81]
|
||||
_ = x[IBS-82]
|
||||
_ = x[IBSBRNTRGT-83]
|
||||
_ = x[IBSFETCHSAM-84]
|
||||
_ = x[IBSFFV-85]
|
||||
_ = x[IBSOPCNT-86]
|
||||
_ = x[IBSOPCNTEXT-87]
|
||||
_ = x[IBSOPSAM-88]
|
||||
_ = x[IBSRDWROPCNT-89]
|
||||
_ = x[IBSRIPINVALIDCHK-90]
|
||||
_ = x[IBS_FETCH_CTLX-91]
|
||||
_ = x[IBS_OPDATA4-92]
|
||||
_ = x[IBS_OPFUSE-93]
|
||||
_ = x[IBS_PREVENTHOST-94]
|
||||
_ = x[IBS_ZEN4-95]
|
||||
_ = x[IDPRED_CTRL-96]
|
||||
_ = x[INT_WBINVD-97]
|
||||
_ = x[INVLPGB-98]
|
||||
_ = x[KEYLOCKER-99]
|
||||
_ = x[KEYLOCKERW-100]
|
||||
_ = x[LAHF-101]
|
||||
_ = x[LAM-102]
|
||||
_ = x[LBRVIRT-103]
|
||||
_ = x[LZCNT-104]
|
||||
_ = x[MCAOVERFLOW-105]
|
||||
_ = x[MCDT_NO-106]
|
||||
_ = x[MCOMMIT-107]
|
||||
_ = x[MD_CLEAR-108]
|
||||
_ = x[MMX-109]
|
||||
_ = x[MMXEXT-110]
|
||||
_ = x[MOVBE-111]
|
||||
_ = x[MOVDIR64B-112]
|
||||
_ = x[MOVDIRI-113]
|
||||
_ = x[MOVSB_ZL-114]
|
||||
_ = x[MOVU-115]
|
||||
_ = x[MPX-116]
|
||||
_ = x[MSRIRC-117]
|
||||
_ = x[MSRLIST-118]
|
||||
_ = x[MSR_PAGEFLUSH-119]
|
||||
_ = x[NRIPS-120]
|
||||
_ = x[NX-121]
|
||||
_ = x[OSXSAVE-122]
|
||||
_ = x[PCONFIG-123]
|
||||
_ = x[POPCNT-124]
|
||||
_ = x[PPIN-125]
|
||||
_ = x[PREFETCHI-126]
|
||||
_ = x[PSFD-127]
|
||||
_ = x[RDPRU-128]
|
||||
_ = x[RDRAND-129]
|
||||
_ = x[RDSEED-130]
|
||||
_ = x[RDTSCP-131]
|
||||
_ = x[RRSBA_CTRL-132]
|
||||
_ = x[RTM-133]
|
||||
_ = x[RTM_ALWAYS_ABORT-134]
|
||||
_ = x[SBPB-135]
|
||||
_ = x[SERIALIZE-136]
|
||||
_ = x[SEV-137]
|
||||
_ = x[SEV_64BIT-138]
|
||||
_ = x[SEV_ALTERNATIVE-139]
|
||||
_ = x[SEV_DEBUGSWAP-140]
|
||||
_ = x[SEV_ES-141]
|
||||
_ = x[SEV_RESTRICTED-142]
|
||||
_ = x[SEV_SNP-143]
|
||||
_ = x[SGX-144]
|
||||
_ = x[SGXLC-145]
|
||||
_ = x[SHA-146]
|
||||
_ = x[SME-147]
|
||||
_ = x[SME_COHERENT-148]
|
||||
_ = x[SPEC_CTRL_SSBD-149]
|
||||
_ = x[SRBDS_CTRL-150]
|
||||
_ = x[SRSO_MSR_FIX-151]
|
||||
_ = x[SRSO_NO-152]
|
||||
_ = x[SRSO_USER_KERNEL_NO-153]
|
||||
_ = x[SSE-154]
|
||||
_ = x[SSE2-155]
|
||||
_ = x[SSE3-156]
|
||||
_ = x[SSE4-157]
|
||||
_ = x[SSE42-158]
|
||||
_ = x[SSE4A-159]
|
||||
_ = x[SSSE3-160]
|
||||
_ = x[STIBP-161]
|
||||
_ = x[STIBP_ALWAYSON-162]
|
||||
_ = x[STOSB_SHORT-163]
|
||||
_ = x[SUCCOR-164]
|
||||
_ = x[SVM-165]
|
||||
_ = x[SVMDA-166]
|
||||
_ = x[SVMFBASID-167]
|
||||
_ = x[SVML-168]
|
||||
_ = x[SVMNP-169]
|
||||
_ = x[SVMPF-170]
|
||||
_ = x[SVMPFT-171]
|
||||
_ = x[SYSCALL-172]
|
||||
_ = x[SYSEE-173]
|
||||
_ = x[TBM-174]
|
||||
_ = x[TDX_GUEST-175]
|
||||
_ = x[TLB_FLUSH_NESTED-176]
|
||||
_ = x[TME-177]
|
||||
_ = x[TOPEXT-178]
|
||||
_ = x[TSCRATEMSR-179]
|
||||
_ = x[TSXLDTRK-180]
|
||||
_ = x[VAES-181]
|
||||
_ = x[VMCBCLEAN-182]
|
||||
_ = x[VMPL-183]
|
||||
_ = x[VMSA_REGPROT-184]
|
||||
_ = x[VMX-185]
|
||||
_ = x[VPCLMULQDQ-186]
|
||||
_ = x[VTE-187]
|
||||
_ = x[WAITPKG-188]
|
||||
_ = x[WBNOINVD-189]
|
||||
_ = x[WRMSRNS-190]
|
||||
_ = x[X87-191]
|
||||
_ = x[XGETBV1-192]
|
||||
_ = x[XOP-193]
|
||||
_ = x[XSAVE-194]
|
||||
_ = x[XSAVEC-195]
|
||||
_ = x[XSAVEOPT-196]
|
||||
_ = x[XSAVES-197]
|
||||
_ = x[AESARM-198]
|
||||
_ = x[ARMCPUID-199]
|
||||
_ = x[ASIMD-200]
|
||||
_ = x[ASIMDDP-201]
|
||||
_ = x[ASIMDHP-202]
|
||||
_ = x[ASIMDRDM-203]
|
||||
_ = x[ATOMICS-204]
|
||||
_ = x[CRC32-205]
|
||||
_ = x[DCPOP-206]
|
||||
_ = x[EVTSTRM-207]
|
||||
_ = x[FCMA-208]
|
||||
_ = x[FHM-209]
|
||||
_ = x[FP-210]
|
||||
_ = x[FPHP-211]
|
||||
_ = x[GPA-212]
|
||||
_ = x[JSCVT-213]
|
||||
_ = x[LRCPC-214]
|
||||
_ = x[PMULL-215]
|
||||
_ = x[RNDR-216]
|
||||
_ = x[TLB-217]
|
||||
_ = x[TS-218]
|
||||
_ = x[SHA1-219]
|
||||
_ = x[SHA2-220]
|
||||
_ = x[SHA3-221]
|
||||
_ = x[SHA512-222]
|
||||
_ = x[SM3-223]
|
||||
_ = x[SM4-224]
|
||||
_ = x[SVE-225]
|
||||
_ = x[lastID-226]
|
||||
_ = x[firstID-0]
|
||||
}
|
||||
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 73, 76, 81, 90, 99, 108, 112, 122, 134, 142, 150, 158, 166, 173, 183, 193, 201, 211, 222, 230, 240, 258, 273, 280, 292, 299, 306, 317, 329, 337, 341, 345, 351, 356, 364, 369, 375, 379, 388, 406, 414, 421, 425, 429, 443, 449, 453, 457, 466, 470, 474, 479, 484, 488, 492, 499, 503, 506, 512, 515, 518, 528, 538, 551, 564, 568, 579, 583, 597, 614, 617, 627, 638, 644, 652, 663, 671, 683, 699, 713, 724, 734, 749, 757, 768, 778, 785, 794, 804, 808, 811, 818, 823, 834, 841, 848, 856, 859, 865, 870, 879, 886, 894, 898, 901, 907, 914, 927, 932, 934, 941, 948, 954, 958, 967, 971, 976, 982, 988, 994, 1004, 1007, 1023, 1027, 1036, 1039, 1048, 1063, 1076, 1082, 1096, 1103, 1106, 1111, 1114, 1117, 1129, 1143, 1153, 1165, 1172, 1191, 1194, 1198, 1202, 1206, 1211, 1216, 1221, 1226, 1240, 1251, 1257, 1260, 1265, 1274, 1278, 1283, 1288, 1294, 1301, 1306, 1309, 1318, 1334, 1337, 1343, 1353, 1361, 1365, 1374, 1378, 1390, 1393, 1403, 1406, 1413, 1421, 1428, 1431, 1438, 1441, 1446, 1452, 1460, 1466, 1472, 1480, 1485, 1492, 1499, 1507, 1514, 1519, 1524, 1531, 1535, 1537, 1541, 1544, 1549, 1554, 1559, 1563, 1567, 1571, 1577, 1580, 1583, 1586, 1592}
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 90, 93, 98, 107, 116, 125, 129, 139, 151, 159, 167, 175, 183, 190, 200, 210, 218, 228, 239, 247, 257, 275, 290, 297, 309, 316, 323, 334, 346, 354, 358, 362, 368, 373, 381, 386, 392, 396, 405, 423, 431, 438, 442, 446, 460, 466, 470, 474, 483, 487, 491, 496, 501, 505, 509, 516, 520, 523, 529, 532, 535, 545, 555, 568, 581, 585, 596, 600, 614, 631, 634, 644, 655, 661, 669, 680, 688, 700, 716, 730, 741, 751, 766, 774, 785, 795, 802, 811, 821, 825, 828, 835, 840, 851, 858, 865, 873, 876, 882, 887, 896, 903, 911, 915, 918, 924, 931, 944, 949, 951, 958, 965, 971, 975, 984, 988, 993, 999, 1005, 1011, 1021, 1024, 1040, 1044, 1053, 1056, 1065, 1080, 1093, 1099, 1113, 1120, 1123, 1128, 1131, 1134, 1146, 1160, 1170, 1182, 1189, 1208, 1211, 1215, 1219, 1223, 1228, 1233, 1238, 1243, 1257, 1268, 1274, 1277, 1282, 1291, 1295, 1300, 1305, 1311, 1318, 1323, 1326, 1335, 1351, 1354, 1360, 1370, 1378, 1382, 1391, 1395, 1407, 1410, 1420, 1423, 1430, 1438, 1445, 1448, 1455, 1458, 1463, 1469, 1477, 1483, 1489, 1497, 1502, 1509, 1516, 1524, 1531, 1536, 1541, 1548, 1552, 1555, 1557, 1561, 1564, 1569, 1574, 1579, 1583, 1586, 1588, 1592, 1596, 1600, 1606, 1609, 1612, 1615, 1621}
|
||||
|
||||
func (i FeatureID) String() string {
|
||||
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
|
||||
|
||||
Some files were not shown because too many files have changed in this diff Show More
Reference in New Issue
Block a user