🎉 Release 2.0.4 (#1214)

* 🎉 Release 2.0.3

* 🎉 Release 2.0.3

.github/workflows/labels.yml

@@ -4,6 +4,8 @@ on:
     types: [opened, labeled, unlabeled, synchronize]
 jobs:
   label:
+    # Only run if PR is not from a fork
+    if: github.event.pull_request.head.repo.full_name == github.repository
     runs-on: ubuntu-latest
     permissions:
       issues: write

.make/go.mk

@@ -18,20 +18,21 @@ SOURCES ?= $(shell find . -name "*.go" -type f -not -path "./node_modules/*")
 TAGS ?=
 
 ifndef OUTPUT
-	ifneq ($(CI_COMMIT_TAG),)
-		OUTPUT ?= $(subst v,,$(CI_COMMIT_TAG))
+	ifneq ($(DRONE_TAG),)
+		OUTPUT ?= $(subst v,,$(DRONE_TAG))
 	else
 		OUTPUT ?= testing
 	endif
 endif
 
-ifeq ($(VERSION), daily)
-	STRING ?= $(shell git rev-parse --short HEAD)
-else ifeq ($(VERSION),)
-	STRING ?= $(shell git rev-parse --short HEAD)
+ifndef VERSION
+	ifneq ($(DRONE_TAG),)
+		VERSION ?= $(subst v,,$(DRONE_TAG))
+	else
+		STRING ?= $(shell git rev-parse --short HEAD)
+	endif
 endif
 
-
 ifndef DATE
 	DATE := $(shell date -u '+%Y%m%d')
 endif

.woodpecker.env

@@ -1,3 +1,3 @@
 # The test runner source for UI tests
-WEB_COMMITID=25629bf0d846051ec0ed6f56ddbeb1a4de6f9ba0
-WEB_BRANCH=main
+WEB_COMMITID=59e329cc5fe288cf247cc5272547a77ac59cc000
+WEB_BRANCH=stable-2.1

CHANGELOG.md

@@ -1,45 +1,53 @@
 # Changelog
 
-## [2.1.0](https://github.com/opencloud-eu/opencloud/releases/tag/v2.1.0) - 2025-04-07
+## [2.0.4](https://github.com/opencloud-eu/opencloud/releases/tag/v2.0.4) - 2025-07-11
 
 ### ❤️ Thanks to all contributors! ❤️
 
-@AlexAndBear, @JammingBen, @ScharfViktor, @aduffeck, @butonic, @fschade, @individual-it, @kulmann, @micbar, @michaelstingl, @rhafer
+@micbar
 
 ### 🐛 Bug Fixes
 
-- feat(antivirus): add partial scanning mode [[#559](https://github.com/opencloud-eu/opencloud/pull/559)]
-- Simplify item-trashed SSEs. Also fixes it for coll. posix fs. [[#565](https://github.com/opencloud-eu/opencloud/pull/565)]
-- fix(opencloud_full): add missing SMTP env vars [[#563](https://github.com/opencloud-eu/opencloud/pull/563)]
-- fix: full deployment tika description is wrong [[#553](https://github.com/opencloud-eu/opencloud/pull/553)]
-- fix: traefik credentials [[#555](https://github.com/opencloud-eu/opencloud/pull/555)]
-- Enable scan/watch in the storageprovider only [[#546](https://github.com/opencloud-eu/opencloud/pull/546)]
-- fix: typo in dev docs [[#540](https://github.com/opencloud-eu/opencloud/pull/540)]
+- [Backport] fix: build_args is now an object [[#1213](https://github.com/opencloud-eu/opencloud/pull/1213)]
 
-### 📈 Enhancement
+## [2.0.3](https://github.com/opencloud-eu/opencloud/releases/tag/v2.0.3) - 2025-07-10
 
-- [full-ci] reva bump 2.31.0 [[#599](https://github.com/opencloud-eu/opencloud/pull/599)]
-- feat: support svg as icon [[#538](https://github.com/opencloud-eu/opencloud/pull/538)]
-- feat: change theme.json primary color [[#536](https://github.com/opencloud-eu/opencloud/pull/536)]
-- graph: reduce memory allocations [[#494](https://github.com/opencloud-eu/opencloud/pull/494)]
+### ❤️ Thanks to all contributors! ❤️
 
-### ✅ Tests
-
-- [full-ci] fix expected spanish string in test [[#596](https://github.com/opencloud-eu/opencloud/pull/596)]
-- Revert "Disable the 'exclude' patterns on the path conditional for now" [[#561](https://github.com/opencloud-eu/opencloud/pull/561)]
+@ScharfViktor
 
 ### 📦️ Dependencies
 
-- build(deps): bump github.com/go-playground/validator/v10 from 10.25.0 to 10.26.0 [[#571](https://github.com/opencloud-eu/opencloud/pull/571)]
-- build(deps): bump github.com/nats-io/nats.go from 1.39.1 to 1.41.0 [[#567](https://github.com/opencloud-eu/opencloud/pull/567)]
-- [full-ci] chore(web): bump web to v2.2.0 [[#570](https://github.com/opencloud-eu/opencloud/pull/570)]
-- build(deps): bump github.com/onsi/gomega from 1.36.3 to 1.37.0 [[#566](https://github.com/opencloud-eu/opencloud/pull/566)]
-- build(deps): bump golang.org/x/net from 0.37.0 to 0.38.0 [[#557](https://github.com/opencloud-eu/opencloud/pull/557)]
-- build(deps-dev): bump eslint-plugin-jsx-a11y from 6.9.0 to 6.10.2 in /services/idp [[#542](https://github.com/opencloud-eu/opencloud/pull/542)]
-- build(deps): bump web-vitals from 3.5.2 to 4.2.4 in /services/idp [[#541](https://github.com/opencloud-eu/opencloud/pull/541)]
-- build(deps): bump github.com/open-policy-agent/opa from 1.2.0 to 1.3.0 [[#508](https://github.com/opencloud-eu/opencloud/pull/508)]
-- build(deps): bump github.com/urfave/cli/v2 from 2.27.5 to 2.27.6 [[#509](https://github.com/opencloud-eu/opencloud/pull/509)]
-- fix keycloak example #465 [[#535](https://github.com/opencloud-eu/opencloud/pull/535)]
+- [full-ci] Reva bump 2.29.4 [[#1202](https://github.com/opencloud-eu/opencloud/pull/1202)]
+
+## [2.0.2](https://github.com/opencloud-eu/opencloud/releases/tag/v2.0.2) - 2025-05-02
+
+### ❤️ Thanks to all contributors! ❤️
+
+@ScharfViktor
+
+### 🐛 Bug Fixes
+
+- Abort when the space root has already been created [[#766](https://github.com/opencloud-eu/opencloud/pull/766)]
+
+## [2.0.1](https://github.com/opencloud-eu/opencloud/releases/tag/v2.0.1) - 2025-04-28
+
+### ❤️ Thanks to all contributors! ❤️
+
+@JammingBen, @ScharfViktor, @fschade, @micbar
+
+### 🐛 Bug Fixes
+
+- fix(decomposeds3): enable async-uploads by default (#686) [[#694](https://github.com/opencloud-eu/opencloud/pull/694)]
+- fix(antivirus | backport): introduce a default max scan size for the full example deployment [[#620](https://github.com/opencloud-eu/opencloud/pull/620)]
+- [full-ci] chore(web): bump web to v2.1.1 [[#638](https://github.com/opencloud-eu/opencloud/pull/638)]
+
+### 📦️ Dependencies
+
+- chore: prepare release, bump version [[#731](https://github.com/opencloud-eu/opencloud/pull/731)]
+- Port #567 [[#689](https://github.com/opencloud-eu/opencloud/pull/689)]
+- chore: bump reva to v2.29.2 [[#681](https://github.com/opencloud-eu/opencloud/pull/681)]
+- build(deps): bump github.com/nats-io/nats-server/v2 [[#683](https://github.com/opencloud-eu/opencloud/pull/683)]
 
 ## [2.0.0](https://github.com/opencloud-eu/opencloud/releases/tag/v2.0.0) - 2025-03-26
 

README.md

@@ -1,6 +1,6 @@
 ![OpenCloud logo](https://raw.githubusercontent.com/opencloud-eu/opencloud/refs/heads/main/opencloud_logo.png)
 
-[![status-badge](https://ci.opencloud.eu/api/badges/3/status.svg)](https://ci.opencloud.eu/repos/3)
+[![status-badge](https://ci.opencloud.eu/api/badges/3/status.svg?branch=stable-2.0)](https://ci.opencloud.eu/repos/3/branches/stable-2.0)
  [![Matrix](https://img.shields.io/matrix/opencloud%3Amatrix.org?logo=matrix)](https://app.element.io/#/room/#opencloud:matrix.org)
  [![License](https://img.shields.io/badge/License-Apache%202.0-blue.svg)](https://opensource.org/licenses/Apache-2.0)
 

deployments/examples/bare-metal-simple/README.md

@@ -26,26 +26,14 @@ This script should **NOT** be run as user root.
 Set the environment variable `OC_VERSION` to the version you want
 to download. If not set, there is a reasonable default. 
 
-## Data Location
-
-Set the environment variable `OC_BASE_DIR` to a directory where the
-`data` and `config` subdirectories shall be located. Per default,
-both configuration and storage data are within a sandbox subdirectory
-in the current working directory.
-
-## Server Address
-
-Set the environment variable `OC_HOST` to the fully qualified hostname
-of this server to allow remote accesse. Default: `localhost`.
-
 # Example
 
 Call
 
 ```
-OC_VERSION="2.0.0" ./install.sh
+OC_VERSION="1.0.0" ./install.sh
 ``` 
-to install the OpenCloud version 2.0.0
+to install the OpenCloud version 1.0.0
 
 There is also a hosted version of this script that makes it even
 easier:

deployments/examples/bare-metal-simple/install.sh

@@ -37,7 +37,7 @@ function backup_file () {
 # URL pattern of the download file
 # https://github.com/opencloud-eu/opencloud/releases/download/v1.0.0/opencloud-1.0.0-linux-amd64
 
-dlversion="${OC_VERSION:-2.0.0}"
+dlversion="${OC_VERSION:-1.1.0}"
 dlurl="https://github.com/opencloud-eu/opencloud/releases/download/v${dlversion}/"
 
 sandbox="opencloud-sandbox-${dlversion}"
@@ -69,14 +69,14 @@ echo "Downloading ${dlurl}/${dlfile}"
 curl -L -o "${dlfile}" --progress-bar "${dlurl}/${dlfile}"
 chmod 755 ${dlfile}
 
-basedir="${OC_BASE_DIR:-$(pwd)}"
-export OC_CONFIG_DIR="$basedir/config"
-export OC_BASE_DATA_PATH="$basedir/data"
-mkdir -p "$OC_CONFIG_DIR" "$OC_BASE_DATA_PATH"
+mkdir data config
+
+export OC_CONFIG_DIR="$(pwd)/config"
+export OC_BASE_DATA_PATH="$(pwd)/data"
 
 # It is bound to localhost for now to deal with non existing routes
 # to certain host names for example in WSL
-host="${OC_HOST:-localhost}"
+host="localhost"
 
 ./${dlfile} init --insecure yes --ap admin
 

deployments/examples/opencloud_full/.env

@@ -17,9 +17,7 @@ TRAEFIK_DASHBOARD=
 # Defaults to "traefik.opencloud.test"
 TRAEFIK_DOMAIN=
 # Basic authentication for the traefik dashboard.
-# Defaults to user "admin" and password "admin" (written as: "admin:$2y$05$KDHu3xq92SPaO3G8Ybkc7edd51pPLJcG1nWk3lmlrIdANQ/B6r5pq").
-# To create user:password pair, it's possible to use this command:
-# echo $(htpasswd -nB user) | sed -e s/\\$/\\$\\$/g
+# Defaults to user "admin" and password "admin" (written as: "admin:admin").
 TRAEFIK_BASIC_AUTH_USERS=
 # Email address for obtaining LetsEncrypt certificates.
 # Needs only be changed if this is a public facing server.
@@ -64,8 +62,6 @@ LOG_LEVEL=
 # LOG_PRETTY=true
 #
 # Define the openCloud storage location. Set the paths for config and data to a local path.
-# Ensure that the configuration and data directories are owned by the user and group with ID 1000:1000.
-# This matches the default user inside the container and avoids permission issues when accessing files.
 # Note that especially the data directory can grow big.
 # Leaving it default stores data in docker internal volumes.
 # OC_CONFIG_DIR=/your/local/opencloud/config
@@ -102,7 +98,7 @@ MINIO_DOMAIN=
 # Note: the leading colon is required to enable the service.
 #DECOMPOSED=:decomposed.yml
 
-# Define SMTP settings if you would like to send OpenCloud email notifications.
+# Define SMPT settings if you would like to send OpenCloud email notifications.
 #
 # NOTE: when configuring Inbucket, these settings have no effect, see inbucket.yml for details.
 # SMTP host to connect to.
@@ -118,8 +114,6 @@ SMTP_USERNAME=
 SMTP_PASSWORD=
 # Authentication method for the SMTP communication.
 SMTP_AUTHENTICATION=
-# Encryption method for the SMTP communication. Possible values are 'starttls', 'ssltls' and 'none'
-SMTP_TRANSPORT_ENCRYPTION=
 # Allow insecure connections to the SMTP server. Defaults to false.
 SMTP_INSECURE=
 
@@ -163,7 +157,7 @@ COMPANION_ONEDRIVE_SECRET=
 ## Default Enabled Services ##
 
 ### Apache Tika Content Analysis Toolkit ###
-# Tika (search) is disabled by default due to performance reasons.
+# Tika (search) is enabled by default, comment if not required.
 # Note: the leading colon is required to enable the service.
 #TIKA=:tika.yml
 # Set the desired docker image tag or digest.
@@ -220,9 +214,6 @@ COLLABORA_SSL_VERIFICATION=false
 # Usable common abbreviations: [KB, KiB, MB, MiB, GB, GiB, TB, TiB, PB, PiB, EB, EiB], example: 2GB.
 # Defaults to "100MB"
 #ANTIVIRUS_MAX_SCAN_SIZE=
-# Usable modes: partial, skip.
-# Defaults to "partial"
-#ANTIVIRUS_MAX_SCAN_SIZE_MODE=
 # Image version of the ClamAV container.
 # Defaults to "latest"
 CLAMAV_DOCKER_TAG=
@@ -250,31 +241,8 @@ INBUCKET_DOMAIN=
 # Path separator for supplemental compose files specified in COMPOSE_FILE.
 COMPOSE_PATH_SEPARATOR=:
 
-### Keycloak Settings ###
-# Note: the leading colon is required to enable the service.
-#KEYCLOAK=:keycloak.yml
-# Domain for Keycloak. Defaults to "keycloak.opencloud.test".
-KEYCLOAK_DOMAIN=
-# Realm which to be used with OpenCloud. Defaults to "OpenCloud"
-KEYCLOAK_REALM=
-# Admin user login name. Defaults to "admin"
-KEYCLOAK_ADMIN_USER=
-# Admin user login password. Defaults to "admin"
-KEYCLOAK_ADMIN_PASSWORD=
-
-### Ldap Settings ###
-# Note: the leading colon is required to enable the service.
-#LDAP=:ldap.yml
-# Password of LDAP user "cn=admin,dc=opencloud,dc=eu". Defaults to "admin"
-LDAP_ADMIN_PASSWORD=
-# LDAP manager
-# login with uid ldapadmin and password
-#LDAP_MANAGER=:../shared/config/ldap/docker-compose.yml
-# LDAP manager domain. Defaults to "ldap.opencloud.test"
-LDAP_MANAGER_DOMAIN=
-
 ## IMPORTANT ##
 # This MUST be the last line as it assembles the supplemental compose files to be used.
 # ALL supplemental configs must be added here, whether commented or not.
 # Each var must either be empty or contain :path/file.yml
-COMPOSE_FILE=docker-compose.yml${OPENCLOUD:-}${TIKA:-}${DECOMPOSEDS3:-}${DECOMPOSEDS3_MINIO:-}${DECOMPOSED:-}${COLLABORA:-}${MONITORING:-}${IMPORTER:-}${CLAMAV:-}${ONLYOFFICE:-}${INBUCKET:-}${EXTENSIONS:-}${UNZIP:-}${DRAWIO:-}${JSONVIEWER:-}${PROGRESSBARS:-}${EXTERNALSITES:-}${KEYCLOAK:-}${LDAP:-}${LDAP_MANAGER:-}
+COMPOSE_FILE=docker-compose.yml${OPENCLOUD:-}${TIKA:-}${DECOMPOSEDS3:-}${DECOMPOSEDS3_MINIO:-}${DECOMPOSED:-}${COLLABORA:-}${MONITORING:-}${IMPORTER:-}${CLAMAV:-}${ONLYOFFICE:-}${INBUCKET:-}${EXTENSIONS:-}${UNZIP:-}${DRAWIO:-}${JSONVIEWER:-}${PROGRESSBARS:-}${EXTERNALSITES:-}

deployments/examples/opencloud_full/clamav.yml

@@ -4,7 +4,6 @@ services:
     environment:
       ANTIVIRUS_SCANNER_TYPE: "clamav"
       ANTIVIRUS_CLAMAV_SOCKET: "/var/run/clamav/clamd.sock"
-      ANTIVIRUS_MAX_SCAN_SIZE_MODE: ${ANTIVIRUS_MAX_SCAN_SIZE_MODE:-partial}
       ANTIVIRUS_MAX_SCAN_SIZE: ${ANTIVIRUS_MAX_SCAN_SIZE:-100MB}
       # the antivirus service needs manual startup, see .env and opencloud.yaml for START_ADDITIONAL_SERVICES
       # configure the antivirus service

deployments/examples/opencloud_full/config/keycloak/clients/OpenCloudAndroid.json

@@ -1,63 +0,0 @@
-{
-  "clientId": "OpenCloudAndroid",
-  "name": "OpenCloud Android App",
-  "surrogateAuthRequired": false,
-  "enabled": true,
-  "alwaysDisplayInConsole": false,
-  "clientAuthenticatorType": "client-secret",
-  "redirectUris": [
-    "oc://android.opencloud.eu"
-  ],
-  "webOrigins": [],
-  "notBefore": 0,
-  "bearerOnly": false,
-  "consentRequired": false,
-  "standardFlowEnabled": true,
-  "implicitFlowEnabled": false,
-  "directAccessGrantsEnabled": true,
-  "serviceAccountsEnabled": false,
-  "publicClient": true,
-  "frontchannelLogout": false,
-  "protocol": "openid-connect",
-  "attributes": {
-    "saml.assertion.signature": "false",
-    "saml.force.post.binding": "false",
-    "saml.multivalued.roles": "false",
-    "saml.encrypt": "false",
-    "post.logout.redirect.uris": "oc://android.opencloud.eu",
-    "backchannel.logout.revoke.offline.tokens": "false",
-    "saml.server.signature": "false",
-    "saml.server.signature.keyinfo.ext": "false",
-    "exclude.session.state.from.auth.response": "false",
-    "backchannel.logout.session.required": "true",
-    "client_credentials.use_refresh_token": "false",
-    "saml_force_name_id_format": "false",
-    "saml.client.signature": "false",
-    "tls.client.certificate.bound.access.tokens": "false",
-    "saml.authnstatement": "false",
-    "display.on.consent.screen": "false",
-    "saml.onetimeuse.condition": "false"
-  },
-  "authenticationFlowBindingOverrides": {},
-  "fullScopeAllowed": true,
-  "nodeReRegistrationTimeout": -1,
-  "defaultClientScopes": [
-    "web-origins",
-    "profile",
-    "roles",
-    "groups",
-    "basic",
-    "email"
-  ],
-  "optionalClientScopes": [
-    "address",
-    "phone",
-    "offline_access",
-    "microprofile-jwt"
-  ],
-  "access": {
-    "view": true,
-    "configure": true,
-    "manage": true
-  }
-}

deployments/examples/opencloud_full/config/keycloak/clients/OpenCloudDesktop.json

@@ -1,64 +0,0 @@
-{
-  "clientId": "OpenCloudDesktop",
-  "name": "OpenCloud Desktop Client",
-  "surrogateAuthRequired": false,
-  "enabled": true,
-  "alwaysDisplayInConsole": false,
-  "clientAuthenticatorType": "client-secret",
-  "redirectUris": [
-    "http://127.0.0.1",
-    "http://localhost"
-  ],
-  "webOrigins": [],
-  "notBefore": 0,
-  "bearerOnly": false,
-  "consentRequired": false,
-  "standardFlowEnabled": true,
-  "implicitFlowEnabled": false,
-  "directAccessGrantsEnabled": true,
-  "serviceAccountsEnabled": false,
-  "publicClient": true,
-  "frontchannelLogout": false,
-  "protocol": "openid-connect",
-  "attributes": {
-    "saml.assertion.signature": "false",
-    "saml.force.post.binding": "false",
-    "saml.multivalued.roles": "false",
-    "saml.encrypt": "false",
-    "post.logout.redirect.uris": "+",
-    "backchannel.logout.revoke.offline.tokens": "false",
-    "saml.server.signature": "false",
-    "saml.server.signature.keyinfo.ext": "false",
-    "exclude.session.state.from.auth.response": "false",
-    "backchannel.logout.session.required": "true",
-    "client_credentials.use_refresh_token": "false",
-    "saml_force_name_id_format": "false",
-    "saml.client.signature": "false",
-    "tls.client.certificate.bound.access.tokens": "false",
-    "saml.authnstatement": "false",
-    "display.on.consent.screen": "false",
-    "saml.onetimeuse.condition": "false"
-  },
-  "authenticationFlowBindingOverrides": {},
-  "fullScopeAllowed": true,
-  "nodeReRegistrationTimeout": -1,
-  "defaultClientScopes": [
-    "web-origins",
-    "profile",
-    "roles",
-    "groups",
-    "basic",
-    "email"
-  ],
-  "optionalClientScopes": [
-    "address",
-    "phone",
-    "offline_access",
-    "microprofile-jwt"
-  ],
-  "access": {
-    "view": true,
-    "configure": true,
-    "manage": true
-  }
-}

deployments/examples/opencloud_full/config/keycloak/clients/OpenCloudIOS.json

@@ -1,63 +0,0 @@
-{
-  "clientId": "OpenCloudIOS",
-  "name": "OpenCloud iOS App",
-  "surrogateAuthRequired": false,
-  "enabled": true,
-  "alwaysDisplayInConsole": false,
-  "clientAuthenticatorType": "client-secret",
-  "redirectUris": [
-    "oc://ios.opencloud.eu"
-  ],
-  "webOrigins": [],
-  "notBefore": 0,
-  "bearerOnly": false,
-  "consentRequired": false,
-  "standardFlowEnabled": true,
-  "implicitFlowEnabled": false,
-  "directAccessGrantsEnabled": true,
-  "serviceAccountsEnabled": false,
-  "publicClient": true,
-  "frontchannelLogout": false,
-  "protocol": "openid-connect",
-  "attributes": {
-    "saml.assertion.signature": "false",
-    "saml.force.post.binding": "false",
-    "saml.multivalued.roles": "false",
-    "saml.encrypt": "false",
-    "post.logout.redirect.uris": "oc://ios.opencloud.eu",
-    "backchannel.logout.revoke.offline.tokens": "false",
-    "saml.server.signature": "false",
-    "saml.server.signature.keyinfo.ext": "false",
-    "exclude.session.state.from.auth.response": "false",
-    "backchannel.logout.session.required": "true",
-    "client_credentials.use_refresh_token": "false",
-    "saml_force_name_id_format": "false",
-    "saml.client.signature": "false",
-    "tls.client.certificate.bound.access.tokens": "false",
-    "saml.authnstatement": "false",
-    "display.on.consent.screen": "false",
-    "saml.onetimeuse.condition": "false"
-  },
-  "authenticationFlowBindingOverrides": {},
-  "fullScopeAllowed": true,
-  "nodeReRegistrationTimeout": -1,
-  "defaultClientScopes": [
-    "web-origins",
-    "profile",
-    "roles",
-    "groups",
-    "basic",
-    "email"
-  ],
-  "optionalClientScopes": [
-    "address",
-    "phone",
-    "offline_access",
-    "microprofile-jwt"
-  ],
-  "access": {
-    "view": true,
-    "configure": true,
-    "manage": true
-  }
-}

deployments/examples/opencloud_full/config/keycloak/clients/cyberduck.json

@@ -1,66 +0,0 @@
-{
-  "clientId": "Cyberduck",
-  "name": "Cyberduck",
-  "description": "File transfer utility client",
-  "surrogateAuthRequired": false,
-  "enabled": true,
-  "alwaysDisplayInConsole": false,
-  "clientAuthenticatorType": "client-secret",
-  "redirectUris": [
-    "x-cyberduck-action:oauth",
-    "x-mountainduck-action:oauth"
-  ],
-  "webOrigins": [],
-  "notBefore": 0,
-  "bearerOnly": false,
-  "consentRequired": false,
-  "standardFlowEnabled": true,
-  "implicitFlowEnabled": false,
-  "directAccessGrantsEnabled": true,
-  "serviceAccountsEnabled": false,
-  "publicClient": true,
-  "frontchannelLogout": false,
-  "protocol": "openid-connect",
-  "attributes": {
-    "saml.assertion.signature": "false",
-    "saml.force.post.binding": "false",
-    "saml.multivalued.roles": "false",
-    "saml.encrypt": "false",
-    "oauth2.device.authorization.grant.enabled": "false",
-    "backchannel.logout.revoke.offline.tokens": "false",
-    "saml.server.signature": "false",
-    "saml.server.signature.keyinfo.ext": "false",
-    "exclude.session.state.from.auth.response": "false",
-    "oidc.ciba.grant.enabled": "false",
-    "backchannel.logout.session.required": "true",
-    "client_credentials.use_refresh_token": "false",
-    "saml_force_name_id_format": "false",
-    "saml.client.signature": "false",
-    "tls.client.certificate.bound.access.tokens": "false",
-    "saml.authnstatement": "false",
-    "display.on.consent.screen": "false",
-    "saml.onetimeuse.condition": "false"
-  },
-  "authenticationFlowBindingOverrides": {},
-  "fullScopeAllowed": true,
-  "nodeReRegistrationTimeout": -1,
-  "defaultClientScopes": [
-    "web-origins",
-    "profile",
-    "roles",
-    "groups",
-    "basic",
-    "email"
-  ],
-  "optionalClientScopes": [
-    "address",
-    "phone",
-    "offline_access",
-    "microprofile-jwt"
-  ],
-  "access": {
-    "view": true,
-    "configure": true,
-    "manage": true
-  }
-}

deployments/examples/opencloud_full/config/keycloak/clients/web.json

@@ -1,74 +0,0 @@
-{
-  "clientId": "web",
-  "name": "OpenCloud Web App",
-  "description": "",
-  "rootUrl": "{{OC_URL}}",
-  "adminUrl": "{{OC_URL}}",
-  "baseUrl": "",
-  "surrogateAuthRequired": false,
-  "enabled": true,
-  "alwaysDisplayInConsole": false,
-  "clientAuthenticatorType": "client-secret",
-  "redirectUris": [
-    "{{OC_URL}}/",
-    "{{OC_URL}}/oidc-callback.html",
-    "{{OC_URL}}/oidc-silent-redirect.html"
-  ],
-  "webOrigins": [
-    "{{OC_URL}}"
-  ],
-  "notBefore": 0,
-  "bearerOnly": false,
-  "consentRequired": false,
-  "standardFlowEnabled": true,
-  "implicitFlowEnabled": false,
-  "directAccessGrantsEnabled": true,
-  "serviceAccountsEnabled": false,
-  "publicClient": true,
-  "frontchannelLogout": false,
-  "protocol": "openid-connect",
-  "attributes": {
-    "saml.assertion.signature": "false",
-    "saml.force.post.binding": "false",
-    "saml.multivalued.roles": "false",
-    "saml.encrypt": "false",
-    "post.logout.redirect.uris": "+",
-    "oauth2.device.authorization.grant.enabled": "false",
-    "backchannel.logout.revoke.offline.tokens": "false",
-    "saml.server.signature": "false",
-    "saml.server.signature.keyinfo.ext": "false",
-    "exclude.session.state.from.auth.response": "false",
-    "oidc.ciba.grant.enabled": "false",
-    "backchannel.logout.url": "{{OC_URL}}/backchannel_logout",
-    "backchannel.logout.session.required": "true",
-    "client_credentials.use_refresh_token": "false",
-    "saml_force_name_id_format": "false",
-    "saml.client.signature": "false",
-    "tls.client.certificate.bound.access.tokens": "false",
-    "saml.authnstatement": "false",
-    "display.on.consent.screen": "false",
-    "saml.onetimeuse.condition": "false"
-  },
-  "authenticationFlowBindingOverrides": {},
-  "fullScopeAllowed": true,
-  "nodeReRegistrationTimeout": -1,
-  "defaultClientScopes": [
-    "web-origins",
-    "profile",
-    "roles",
-    "groups",
-    "basic",
-    "email"
-  ],
-  "optionalClientScopes": [
-    "address",
-    "phone",
-    "offline_access",
-    "microprofile-jwt"
-  ],
-  "access": {
-    "view": true,
-    "configure": true,
-    "manage": true
-  }
-}

deployments/examples/opencloud_full/config/keycloak/docker-entrypoint-override.sh

@@ -1,8 +0,0 @@
-#!/bin/bash
-printenv
-# replace openCloud domain in keycloak realm import
-mkdir /opt/keycloak/data/import
-sed -e "s/cloud.opencloud.test/${OC_DOMAIN}/g" /opt/keycloak/data/import-dist/opencloud-realm.json > /opt/keycloak/data/import/opencloud-realm.json
-
-# run original docker-entrypoint
-/opt/keycloak/bin/kc.sh "$@"

deployments/examples/opencloud_full/config/ldap/docker-entrypoint-override.sh

@@ -1,9 +0,0 @@
-#!/bin/bash
-printenv
-
-if [ ! -f /opt/bitnami/openldap/share/openldap.key ]
-then	
-	openssl req -x509 -newkey rsa:4096 -keyout /opt/bitnami/openldap/share/openldap.key -out /opt/bitnami/openldap/share/openldap.crt -sha256 -days 365 -batch -nodes
-fi
-# run original docker-entrypoint
-/opt/bitnami/scripts/openldap/entrypoint.sh "$@"

deployments/examples/opencloud_full/config/ldap/ldif/10_base.ldif

@@ -1,20 +0,0 @@
-dn: dc=opencloud,dc=eu
-objectClass: organization
-objectClass: dcObject
-dc: opencloud
-o: openCloud
-
-dn: ou=users,dc=opencloud,dc=eu
-objectClass: organizationalUnit
-ou: users
-
-dn: cn=admin,dc=opencloud,dc=eu
-objectClass: inetOrgPerson
-objectClass: person
-cn: admin
-sn: admin
-uid: ldapadmin
-
-dn: ou=groups,dc=opencloud,dc=eu
-objectClass: organizationalUnit
-ou: groups

deployments/examples/opencloud_full/config/ldap/ldif/20_users.ldif

@@ -1,125 +0,0 @@
-# Start dn with uid (user identifier / login), not cn (Firstname + Surname)
-dn: uid=alan,ou=users,dc=opencloud,dc=eu
-objectClass: inetOrgPerson
-objectClass: organizationalPerson
-objectClass: openCloudUser
-objectClass: person
-objectClass: posixAccount
-objectClass: top
-uid: alan
-givenName: Alan
-sn: Turing
-cn: alan
-displayName: Alan Turing
-description:  An English mathematician, computer scientist, logician, cryptanalyst, philosopher and theoretical biologist. He was highly influential in the development of theoretical computer science, providing a formalisation of the concepts of algorithm and computation with the Turing machine.
-mail: alan@example.org
-uidNumber: 20000
-gidNumber: 30000
-homeDirectory: /home/alan
-openCloudUUID: b1f74ec4-dd7e-11ef-a543-03775734d0f7
-userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
-
-dn: uid=lynn,ou=users,dc=opencloud,dc=eu
-objectClass: inetOrgPerson
-objectClass: organizationalPerson
-objectClass: openCloudUser
-objectClass: person
-objectClass: posixAccount
-objectClass: top
-uid: lynn
-givenName: Lynn
-sn: Conway
-cn: lynn
-displayName: Lynn Conway
-description:  An American computer scientist, electrical engineer, and transgender activist.
-mail: lynn@example.org
-uidNumber: 20001
-gidNumber: 30000
-homeDirectory: /home/lynn
-openCloudUserEnabled: TRUE
-openCloudUUID: 60708dda-e897-11ef-919f-bbb7437d6ec2
-userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
-
-dn: uid=mary,ou=users,dc=opencloud,dc=eu
-objectClass: inetOrgPerson
-objectClass: organizationalPerson
-objectClass: openCloudUser
-objectClass: person
-objectClass: posixAccount
-objectClass: top
-uid: mary
-givenName: Mary
-sn: Kenneth Keller
-cn: mary
-displayName: Mary Kenneth Keller
-description: Mary Kenneth Keller of the Sisters of Charity of the Blessed Virgin Mary was a pioneer in computer science.
-mail: mary@example.org
-uidNumber: 20002
-gidNumber: 30000
-homeDirectory: /home/mary
-openCloudUserEnabled: TRUE
-openCloudUUID: 056fc874-dd7f-11ef-ba84-af6fca4b7289
-userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
-
-dn: uid=margaret,ou=users,dc=opencloud,dc=eu
-objectClass: inetOrgPerson
-objectClass: organizationalPerson
-objectClass: openCloudUser
-objectClass: person
-objectClass: posixAccount
-objectClass: top
-uid: margaret
-givenName: Margaret
-sn: Hamilton
-cn: margaret
-displayName: Margaret Hamilton
-description: A director of the Software Engineering Division of the MIT Instrumentation Laboratory, which developed on-board flight software for NASA's Apollo program.
-mail: margaret@example.org
-uidNumber: 20003
-gidNumber: 30000
-homeDirectory: /home/margaret
-openCloudUserEnabled: TRUE
-openCloudUUID: 801abee4-dd7f-11ef-a324-83f55a754b62
-userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
-
-dn: uid=dennis,ou=users,dc=opencloud,dc=eu
-objectClass: inetOrgPerson
-objectClass: organizationalPerson
-objectClass: openCloudUser
-objectClass: person
-objectClass: posixAccount
-objectClass: top
-uid: dennis
-givenName: Dennis
-sn: Ritchie
-cn: dennis
-displayName: Dennis Ritchie
-description: American computer scientist. He created the C programming language and the Unix operating system and B language with long-time colleague Ken Thompson.
-mail: dennis@example.org
-uidNumber: 20004
-gidNumber: 30000
-homeDirectory: /home/dennis
-openCloudUserEnabled: TRUE
-openCloudUUID: cd88bf9a-dd7f-11ef-a609-7f78deb2345f
-userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
-
-dn: uid=admin,ou=users,dc=opencloud,dc=eu
-objectClass: inetOrgPerson
-objectClass: organizationalPerson
-objectClass: openCloudUser
-objectClass: person
-objectClass: posixAccount
-objectClass: top
-uid: admin
-givenName: Admin
-sn: Admin
-cn: admin
-displayName: Admin
-description: An admin for this OpenCloud instance.
-mail: admin@example.org
-uidNumber: 20005
-gidNumber: 30000
-homeDirectory: /home/admin
-openCloudUserEnabled: TRUE
-openCloudUUID: f7fc96f6-ceb4-4387-bd69-07a6d7992973
-userPassword:: e1NTSEF9UWhmaFB3dERydTUydURoWFFObDRMbzVIckI3TkI5Nmo==

deployments/examples/opencloud_full/config/ldap/ldif/30_groups.ldif

@@ -1,88 +0,0 @@
-dn: cn=users,ou=groups,dc=opencloud,dc=eu
-objectClass: groupOfNames
-objectClass: openCloudObject
-objectClass: top
-cn: users
-description: Users
-openCloudUUID: 509a9dcd-bb37-4f4f-a01a-19dca27d9cfa
-member: uid=alan,ou=users,dc=opencloud,dc=eu
-member: uid=mary,ou=users,dc=opencloud,dc=eu
-member: uid=margaret,ou=users,dc=opencloud,dc=eu
-member: uid=dennis,ou=users,dc=opencloud,dc=eu
-member: uid=lynn,ou=users,dc=opencloud,dc=eu
-member: uid=admin,ou=users,dc=opencloud,dc=eu
-
-dn: cn=chess-lovers,ou=groups,dc=opencloud,dc=eu
-objectClass: groupOfNames
-objectClass: openCloudObject
-objectClass: top
-cn: chess-lovers
-description: Chess lovers
-openCloudUUID: 9d31ec04-dd80-11ef-ac47-a38ba68cc36d
-member: uid=alan,ou=users,dc=opencloud,dc=eu
-
-dn: cn=machine-lovers,ou=groups,dc=opencloud,dc=eu
-objectClass: groupOfNames
-objectClass: openCloudObject
-objectClass: top
-cn: machine-lovers
-description: Machine Lovers
-openCloudUUID: d901562a-dd80-11ef-a510-fba1ed43fb21
-member: uid=alan,ou=users,dc=opencloud,dc=eu
-
-dn: cn=bible-readers,ou=groups,dc=opencloud,dc=eu
-objectClass: groupOfNames
-objectClass: openCloudObject
-objectClass: top
-cn: bible-readers
-description: Bible readers
-openCloudUUID: 2fc6ba22-dd81-11ef-89e6-e3eff494a998
-member: uid=mary,ou=users,dc=opencloud,dc=eu
-
-dn: cn=apollos,ou=groups,dc=opencloud,dc=eu
-objectClass: groupOfNames
-objectClass: openCloudObject
-objectClass: top
-cn: apollos
-description: Contributors to the Appollo mission
-openCloudUUID: 6f9bab36-dd94-11ef-a252-dbbdd20299dd
-member: uid=margaret,ou=users,dc=opencloud,dc=eu
-
-dn: cn=unix-lovers,ou=groups,dc=opencloud,dc=eu
-objectClass: groupOfNames
-objectClass: openCloudObject
-objectClass: top
-cn: unix-lovers
-description: Unix lovers
-openCloudUUID: 75bc3882-dd94-11ef-ad60-335f3df6cef3
-member: uid=dennis,ou=users,dc=opencloud,dc=eu
-
-dn: cn=basic-haters,ou=groups,dc=opencloud,dc=eu
-objectClass: groupOfNames
-objectClass: openCloudObject
-objectClass: top
-cn: basic-haters
-description: Haters of the Basic programming language
-openCloudUUID: a4eb2c12-dd94-11ef-9ebe-eb96f938d517
-member: uid=dennis,ou=users,dc=opencloud,dc=eu
-
-dn: cn=vlsi-lovers,ou=groups,dc=opencloud,dc=eu
-objectClass: groupOfNames
-objectClass: openCloudObject
-objectClass: top
-cn: vlsi-lovers
-description: Lovers of VLSI microchip design
-openCloudUUID: 914ce3de-e899-11ef-9a4b-732fbb2acc42
-member: uid=lynn,ou=users,dc=opencloud,dc=eu
-
-dn: cn=programmers,ou=groups,dc=opencloud,dc=eu
-objectClass: groupOfNames
-objectClass: openCloudObject
-objectClass: top
-cn: programmers
-description: Computer Programmers
-openCloudUUID: ce4aa240-dd94-11ef-82b8-4f4828849072
-member: uid=alan,ou=users,dc=opencloud,dc=eu
-member: uid=margaret,ou=users,dc=opencloud,dc=eu
-member: uid=dennis,ou=users,dc=opencloud,dc=eu
-member: uid=lynn,ou=users,dc=opencloud,dc=eu

deployments/examples/opencloud_full/config/opencloud/csp.yaml

@@ -7,7 +7,6 @@ directives:
     - 'https://${COMPANION_DOMAIN|companion.opencloud.test}/'
     - 'wss://${COMPANION_DOMAIN|companion.opencloud.test}/'
     - 'https://raw.githubusercontent.com/opencloud-eu/awesome-apps/'
-    - 'https://${KEYCLOAK_DOMAIN|keycloak.opencloud.test}/'
   default-src:
     - '''none'''
   font-src:

deployments/examples/opencloud_full/keycloak.yml

@@ -1,77 +0,0 @@
----
-services:
-  traefik:
-    networks:
-      opencloud-net:
-        aliases:
-          - ${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}
-
-  opencloud:
-    environment:
-      # Keycloak IDP specific configuration
-      PROXY_AUTOPROVISION_ACCOUNTS: "true"
-      PROXY_ROLE_ASSIGNMENT_DRIVER: "oidc"
-      OC_OIDC_ISSUER: https://${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}/realms/${KEYCLOAK_REALM:-openCloud}
-      PROXY_OIDC_REWRITE_WELLKNOWN: "true"
-      WEB_OIDC_CLIENT_ID: ${OC_OIDC_CLIENT_ID:-web}
-
-      PROXY_USER_OIDC_CLAIM: "preferred_username"
-      PROXY_USER_CS3_CLAIM: "username"
-      OC_EXCLUDE_RUN_SERVICES: "idp"
-      
-      # admin and demo accounts must be created in Keycloak
-      OC_ADMIN_USER_ID: ""
-      SETTINGS_SETUP_DEFAULT_ASSIGNMENTS: "false"
-
-      GRAPH_ASSIGN_DEFAULT_USER_ROLE: "false"
-      GRAPH_USERNAME_MATCH: "none"
-      KEYCLOAK_DOMAIN: ${KEYCLOAK_DOMAIN:-keycloak.opencloud.test} 
-
-  postgres:
-    image: postgres:alpine
-    networks:
-      opencloud-net:
-    volumes:
-      - keycloak_postgres_data:/var/lib/postgresql/data
-    environment:
-      POSTGRES_DB: keycloak
-      POSTGRES_USER: keycloak
-      POSTGRES_PASSWORD: keycloak
-    logging:
-      driver: ${LOG_DRIVER:-local}
-    restart: always
-
-  keycloak:
-    image: quay.io/keycloak/keycloak:25.0.0
-    networks:
-      opencloud-net:
-    command: ["start", "--proxy=edge", "--spi-connections-http-client-default-disable-trust-manager=${INSECURE:-false}", "--import-realm"]
-    entrypoint: ["/bin/sh", "/opt/keycloak/bin/docker-entrypoint-override.sh"]
-    volumes:
-      - "./config/keycloak/docker-entrypoint-override.sh:/opt/keycloak/bin/docker-entrypoint-override.sh"
-      - "./config/keycloak/opencloud-realm.dist.json:/opt/keycloak/data/import-dist/opencloud-realm.json"
-    environment:
-      OC_DOMAIN: ${OC_DOMAIN:-cloud.opencloud.test}
-      KC_HOSTNAME: ${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}
-      KC_DB: postgres
-      KC_DB_URL: "jdbc:postgresql://postgres:5432/keycloak"
-      KC_DB_USERNAME: keycloak
-      KC_DB_PASSWORD: keycloak
-      KC_FEATURES: impersonation
-      KEYCLOAK_ADMIN: ${KEYCLOAK_ADMIN_USER:-admin}
-      KEYCLOAK_ADMIN_PASSWORD: ${KEYCLOAK_ADMIN_PASSWORD:-admin}
-    labels:
-      - "traefik.enable=true"
-      - "traefik.http.routers.keycloak.entrypoints=https"
-      - "traefik.http.routers.keycloak.rule=Host(`${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}`)"
-      - "traefik.http.routers.keycloak.tls.certresolver=http"
-      - "traefik.http.routers.keycloak.service=keycloak"
-      - "traefik.http.services.keycloak.loadbalancer.server.port=8080"
-    depends_on:
-      - postgres
-    logging:
-      driver: ${LOG_DRIVER:-local}
-    restart: always
-
-volumes:
-  keycloak_postgres_data:

deployments/examples/opencloud_full/ldap.yml

@@ -1,62 +0,0 @@
----
-services:
-  traefik:
-    networks:
-      opencloud-net:
-
-  opencloud:
-    environment:
-      # Ldap IDP specific configuration
-      OC_LDAP_URI: ldaps://ldap-server:1636
-      OC_LDAP_INSECURE: "true"
-      OC_LDAP_BIND_DN: "cn=admin,dc=opencloud,dc=eu"
-      OC_LDAP_BIND_PASSWORD: ${LDAP_ADMIN_PASSWORD:-admin}
-      OC_LDAP_GROUP_BASE_DN: "ou=groups,dc=opencloud,dc=eu"
-      OC_LDAP_GROUP_FILTER: "(objectclass=opencloudobject)"
-      OC_LDAP_GROUP_OBJECTCLASS: "groupOfNames"
-      OC_LDAP_USER_BASE_DN: "ou=users,dc=opencloud,dc=eu"
-      OC_LDAP_USER_FILTER: "(objectclass=openclouduser)"
-      OC_LDAP_USER_OBJECTCLASS: "inetOrgPerson"
-      LDAP_LOGIN_ATTRIBUTES: "uid"
-      OC_ADMIN_USER_ID: "f7fc96f6-ceb4-4387-bd69-07a6d7992973"
-      IDP_LDAP_LOGIN_ATTRIBUTE: "uid"
-      IDP_LDAP_UUID_ATTRIBUTE: "openclouduuid"
-      IDP_LDAP_UUID_ATTRIBUTE_TYPE: binary
-      GRAPH_LDAP_SERVER_WRITE_ENABLED: "true" # assuming the external ldap is writable
-      GRAPH_LDAP_REFINT_ENABLED: "true" # osixia has refint enabled.
-      # OC_RUN_SERVICES specifies to start all services except glauth, idm and accounts. These are replaced by external services
-      OC_EXCLUDE_RUN_SERVICES: idm
-
-  ldap-server:
-    image: bitnami/openldap:2.6
-    networks:
-      opencloud-net:
-    entrypoint: ["/bin/sh", "/opt/bitnami/scripts/openldap/docker-entrypoint-override.sh", "/opt/bitnami/scripts/openldap/run.sh" ]
-    environment:
-      BITNAMI_DEBUG: true
-      LDAP_TLS_VERIFY_CLIENT: never
-      LDAP_ENABLE_TLS: "yes"
-      LDAP_TLS_CA_FILE: /opt/bitnami/openldap/share/openldap.crt
-      LDAP_TLS_CERT_FILE: /opt/bitnami/openldap/share/openldap.crt
-      LDAP_TLS_KEY_FILE: /opt/bitnami/openldap/share/openldap.key
-      LDAP_ROOT: "dc=opencloud,dc=eu"
-      LDAP_ADMIN_PASSWORD: ${LDAP_ADMIN_PASSWORD:-admin}
-    ports:
-      - "127.0.0.1:389:1389"
-      - "127.0.0.1:636:1636"
-    volumes:
-      - ./config/ldap/ldif:/ldifs
-      - ../shared/config/ldap/schemas/10_opencloud_schema.ldif:/schemas/10_opencloud_schema.ldif
-      - ./config/ldap/docker-entrypoint-override.sh:/opt/bitnami/scripts/openldap/docker-entrypoint-override.sh
-      - ldap-certs:/opt/bitnami/openldap/share
-      - ldap-data:/bitnami/openldap
-    logging:
-      driver: ${LOG_DRIVER:-local}
-    restart: always
-
-volumes:
-  ldap-certs:
-  ldap-data:
-
-networks:
-  opencloud-net:

deployments/examples/opencloud_full/opencloud.yml

@@ -41,11 +41,7 @@ services:
       NOTIFICATIONS_SMTP_PORT: "${SMTP_PORT}"
       NOTIFICATIONS_SMTP_SENDER: "${SMTP_SENDER:-OpenCloud notifications <notifications@${OC_DOMAIN:-cloud.opencloud.test}>}"
       NOTIFICATIONS_SMTP_USERNAME: "${SMTP_USERNAME}"
-      NOTIFICATIONS_SMTP_PASSWORD: "${SMTP_PASSWORD}"
       NOTIFICATIONS_SMTP_INSECURE: "${SMTP_INSECURE}"
-      NOTIFICATIONS_SMTP_AUTHENTICATION: "${SMTP_AUTHENTICATION}"
-      NOTIFICATIONS_SMTP_ENCRYPTION: "${SMTP_TRANSPORT_ENCRYPTION:-none}"
-      FRONTEND_ARCHIVER_MAX_SIZE: "10000000000"
       # make the registry available to the app provider containers
       MICRO_REGISTRY_ADDRESS: 127.0.0.1:9233
       NATS_NATS_HOST: 0.0.0.0

deployments/examples/opencloud_full/web_extensions/unzip.yml

@@ -6,10 +6,12 @@ services:
         condition: service_completed_successfully
 
   unzip-init:
-    image: opencloudeu/web-extensions:unzip-1.0.2
+    image: opencloudeu/web-extensions:unzip-1.0.0
     user: root
     volumes:
       - opencloud-apps:/apps
     entrypoint:
       - /bin/sh
     command: ["-c", "cp -R /usr/share/nginx/html/unzip/ /apps"]
+
+

deployments/examples/shared/config/ldap/docker-compose.yml

@@ -1,24 +0,0 @@
----
-# This file can be used to be added to the opencloud_full example
-# to browse the LDAP server with a web interface.
-# This is not a production ready setup.
-services:
-  ldap-manager:
-    image: phpldapadmin/phpldapadmin:latest
-    networks:
-      opencloud-net:
-    environment:
-      LDAP_HOST: ldap-server
-      LDAP_PORT: 1389
-      LDAP_LOGIN_OBJECTCLASS: "inetOrgPerson"
-      APP_URL: "https://${LDAP_MANAGER_DOMAIN:-ldap.opencloud.test}"
-    labels:
-      - "traefik.enable=true"
-      - "traefik.http.routers.ldap-manager.entrypoints=https"
-      - "traefik.http.routers.ldap-manager.rule=Host(`${LDAP_MANAGER_DOMAIN:-ldap.opencloud.test}`)"
-      - "traefik.http.routers.ldap-manager.tls.certresolver=http"
-      - "traefik.http.routers.ldap-manager.service=ldap-manager"
-      - "traefik.http.services.ldap-manager.loadbalancer.server.port=8080"
-    logging:
-      driver: ${LOG_DRIVER:-local}
-    restart: always

docs/intro.md

@@ -0,0 +1,17 @@
+---
+sidebar_position: 1
+id: intro
+title: OpenCloud Developer Docs
+custom_edit_url: https://github.com/opencloud-eu/opencloud/edit/main/docs/intro.md
+---
+
+# Welcome
+
+Welcome to the OpenCloud Developer Documentation.
+
+Please be patient, we are working on the content.
+
+If you want to contribute to the dev docs, please visit [OpenCloud on Github](https://github.com/opencloud-eu/).
+
+Contents will be transferred, during the build process.
+

go.mod

@@ -13,7 +13,7 @@ require (
 	github.com/beevik/etree v1.5.0
 	github.com/blevesearch/bleve/v2 v2.4.4
 	github.com/cenkalti/backoff v2.2.1+incompatible
-	github.com/coreos/go-oidc/v3 v3.14.1
+	github.com/coreos/go-oidc/v3 v3.13.0
 	github.com/cs3org/go-cs3apis v0.0.0-20241105092511-3ad35d174fc1
 	github.com/davidbyttow/govips/v2 v2.16.0
 	github.com/dhowden/tag v0.0.0-20240417053706-3d75831295e8
@@ -33,7 +33,7 @@ require (
 	github.com/go-micro/plugins/v4/store/nats-js-kv v0.0.0-20240726082623-6831adfdcdc4
 	github.com/go-micro/plugins/v4/wrapper/monitoring/prometheus v1.2.0
 	github.com/go-micro/plugins/v4/wrapper/trace/opentelemetry v1.2.0
-	github.com/go-playground/validator/v10 v10.26.0
+	github.com/go-playground/validator/v10 v10.25.0
 	github.com/gofrs/uuid v4.4.0+incompatible
 	github.com/golang-jwt/jwt/v5 v5.2.2
 	github.com/golang/protobuf v1.5.4
@@ -55,15 +55,15 @@ require (
 	github.com/mitchellh/mapstructure v1.5.0
 	github.com/mna/pigeon v1.3.0
 	github.com/mohae/deepcopy v0.0.0-20170929034955-c48cc78d4826
-	github.com/nats-io/nats-server/v2 v2.11.0
+	github.com/nats-io/nats-server/v2 v2.11.1
 	github.com/nats-io/nats.go v1.41.0
 	github.com/oklog/run v1.1.0
 	github.com/olekukonko/tablewriter v0.0.5
 	github.com/onsi/ginkgo v1.16.5
-	github.com/onsi/ginkgo/v2 v2.23.4
-	github.com/onsi/gomega v1.37.0
-	github.com/open-policy-agent/opa v1.3.0
-	github.com/opencloud-eu/reva/v2 v2.31.0
+	github.com/onsi/ginkgo/v2 v2.23.3
+	github.com/onsi/gomega v1.36.3
+	github.com/open-policy-agent/opa v1.2.0
+	github.com/opencloud-eu/reva/v2 v2.29.4
 	github.com/orcaman/concurrent-map v1.0.0
 	github.com/owncloud/libre-graph-api-go v1.0.5-0.20240829135935-80dc00d6f5ea
 	github.com/pkg/errors v0.9.1
@@ -82,9 +82,9 @@ require (
 	github.com/test-go/testify v1.1.4
 	github.com/thejerf/suture/v4 v4.0.6
 	github.com/tidwall/gjson v1.18.0
-	github.com/tus/tusd/v2 v2.8.0
+	github.com/tus/tusd/v2 v2.7.1
 	github.com/unrolled/secure v1.16.0
-	github.com/urfave/cli/v2 v2.27.6
+	github.com/urfave/cli/v2 v2.27.5
 	github.com/xhit/go-simple-mail/v2 v2.16.0
 	go-micro.dev/v4 v4.11.0
 	go.etcd.io/bbolt v1.4.0
@@ -99,14 +99,14 @@ require (
 	golang.org/x/crypto v0.36.0
 	golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac
 	golang.org/x/image v0.25.0
-	golang.org/x/net v0.38.0
+	golang.org/x/net v0.37.0
 	golang.org/x/oauth2 v0.28.0
 	golang.org/x/sync v0.12.0
 	golang.org/x/term v0.30.0
 	golang.org/x/text v0.23.0
 	google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb
-	google.golang.org/grpc v1.71.1
-	google.golang.org/protobuf v1.36.6
+	google.golang.org/grpc v1.71.0
+	google.golang.org/protobuf v1.36.5
 	gopkg.in/yaml.v2 v2.4.0
 	gotest.tools/v3 v3.5.2
 	stash.kopano.io/kgol/rndm v1.1.2
@@ -216,7 +216,7 @@ require (
 	github.com/gomodule/redigo v1.9.2 // indirect
 	github.com/google/go-querystring v1.1.0 // indirect
 	github.com/google/go-tpm v0.9.3 // indirect
-	github.com/google/pprof v0.0.0-20250403155104-27863c87afa6 // indirect
+	github.com/google/pprof v0.0.0-20241210010833-40e02aabc2ad // indirect
 	github.com/google/renameio/v2 v2.0.0 // indirect
 	github.com/gookit/color v1.5.4 // indirect
 	github.com/gookit/goutil v0.6.15 // indirect
@@ -237,7 +237,7 @@ require (
 	github.com/juliangruber/go-intersect v1.1.0 // indirect
 	github.com/kevinburke/ssh_config v1.2.0 // indirect
 	github.com/klauspost/compress v1.18.0 // indirect
-	github.com/klauspost/cpuid/v2 v2.2.10 // indirect
+	github.com/klauspost/cpuid/v2 v2.2.9 // indirect
 	github.com/leodido/go-urn v1.4.0 // indirect
 	github.com/libregraph/oidc-go v1.1.0 // indirect
 	github.com/longsleep/go-metrics v1.0.0 // indirect
@@ -246,7 +246,7 @@ require (
 	github.com/mattn/go-colorable v0.1.14 // indirect
 	github.com/mattn/go-isatty v0.0.20 // indirect
 	github.com/mattn/go-runewidth v0.0.16 // indirect
-	github.com/mattn/go-sqlite3 v1.14.27 // indirect
+	github.com/mattn/go-sqlite3 v1.14.24 // indirect
 	github.com/maxymania/go-system v0.0.0-20170110133659-647cc364bf0b // indirect
 	github.com/mendsley/gojwk v0.0.0-20141217222730-4d5ec6e58103 // indirect
 	github.com/miekg/dns v1.1.57 // indirect
@@ -254,7 +254,7 @@ require (
 	github.com/minio/crc64nvme v1.0.1 // indirect
 	github.com/minio/highwayhash v1.0.3 // indirect
 	github.com/minio/md5-simd v1.1.2 // indirect
-	github.com/minio/minio-go/v7 v7.0.89 // indirect
+	github.com/minio/minio-go/v7 v7.0.88 // indirect
 	github.com/mitchellh/copystructure v1.2.0 // indirect
 	github.com/mitchellh/reflectwalk v1.0.2 // indirect
 	github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect
@@ -318,15 +318,14 @@ require (
 	go.opentelemetry.io/otel/metric v1.35.0 // indirect
 	go.opentelemetry.io/proto/otlp v1.5.0 // indirect
 	go.uber.org/atomic v1.11.0 // indirect
-	go.uber.org/automaxprocs v1.6.0 // indirect
 	go.uber.org/multierr v1.11.0 // indirect
 	go.uber.org/zap v1.23.0 // indirect
 	golang.org/x/mod v0.24.0 // indirect
-	golang.org/x/sys v0.32.0 // indirect
+	golang.org/x/sys v0.31.0 // indirect
 	golang.org/x/time v0.11.0 // indirect
 	golang.org/x/tools v0.31.0 // indirect
 	golang.org/x/xerrors v0.0.0-20220907171357-04be3eba64a2 // indirect
-	google.golang.org/genproto v0.0.0-20250303144028-a0af3efb3deb // indirect
+	google.golang.org/genproto v0.0.0-20241118233622-e639e219e697 // indirect
 	google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb // indirect
 	gopkg.in/cenkalti/backoff.v1 v1.1.0 // indirect
 	gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 // indirect

go.sum

@@ -222,8 +222,8 @@ github.com/cloudflare/cloudflare-go v0.14.0/go.mod h1:EnwdgGMaFOruiPZRFSgn+TsQ3h
 github.com/cncf/udpa/go v0.0.0-20191209042840-269d4d468f6f/go.mod h1:M8M6+tZqaGXZJjfX53e64911xZQV5JYwmTeXPW+k8Sc=
 github.com/coreos/bbolt v1.3.2/go.mod h1:iRUV2dpdMOn7Bo10OQBFzIJO9kkE559Wcmn+qkEiiKk=
 github.com/coreos/etcd v3.3.13+incompatible/go.mod h1:uF7uidLiAD3TWHmW31ZFd/JWoc32PjwdhPthX9715RE=
-github.com/coreos/go-oidc/v3 v3.14.1 h1:9ePWwfdwC4QKRlCXsJGou56adA/owXczOzwKdOumLqk=
-github.com/coreos/go-oidc/v3 v3.14.1/go.mod h1:HaZ3szPaZ0e4r6ebqvsLWlk2Tn+aejfmrfah6hnSYEU=
+github.com/coreos/go-oidc/v3 v3.13.0 h1:M66zd0pcc5VxvBNM4pB331Wrsanby+QomQYjN8HamW8=
+github.com/coreos/go-oidc/v3 v3.13.0/go.mod h1:HaZ3szPaZ0e4r6ebqvsLWlk2Tn+aejfmrfah6hnSYEU=
 github.com/coreos/go-semver v0.3.0 h1:wkHLiw0WNATZnSG7epLsujiMCgPAc9xhjJ4tgnAxmfM=
 github.com/coreos/go-semver v0.3.0/go.mod h1:nnelYz7RCh+5ahJtPPxZlU+153eP4D4r3EedlOD2RNk=
 github.com/coreos/go-systemd v0.0.0-20190321100706-95778dfbb74e/go.mod h1:F5haX7vjVVG0kc13fIWeqUViNPyEJxv/OmvnBo0Yme4=
@@ -258,8 +258,8 @@ github.com/deckarep/golang-set v1.8.0/go.mod h1:5nI87KwE7wgsBU1F4GKAw2Qod7p5kyS3
 github.com/deepmap/oapi-codegen v1.3.11/go.mod h1:suMvK7+rKlx3+tpa8ByptmvoXbAV70wERKTOGH3hLp0=
 github.com/desertbit/timer v0.0.0-20180107155436-c41aec40b27f h1:U5y3Y5UE0w7amNe7Z5G/twsBW0KEalRQXZzf8ufSh9I=
 github.com/desertbit/timer v0.0.0-20180107155436-c41aec40b27f/go.mod h1:xH/i4TFMt8koVQZ6WFms69WAsDWr2XsYL3Hkl7jkoLE=
-github.com/dgraph-io/badger/v4 v4.6.0 h1:acOwfOOZ4p1dPRnYzvkVm7rUk2Y21TgPVepCy5dJdFQ=
-github.com/dgraph-io/badger/v4 v4.6.0/go.mod h1:KSJ5VTuZNC3Sd+YhvVjk2nYua9UZnnTr/SkXvdtiPgI=
+github.com/dgraph-io/badger/v4 v4.5.1 h1:7DCIXrQjo1LKmM96YD+hLVJ2EEsyyoWxJfpdd56HLps=
+github.com/dgraph-io/badger/v4 v4.5.1/go.mod h1:qn3Be0j3TfV4kPbVoK0arXCD1/nr1ftth6sbL5jxdoA=
 github.com/dgraph-io/ristretto v0.2.0 h1:XAfl+7cmoUDWW/2Lx8TGZQjjxIQ2Ley9DSf52dru4WE=
 github.com/dgraph-io/ristretto v0.2.0/go.mod h1:8uBHCU/PBV4Ag0CJrP47b9Ofby5dqWNh4FicAdoqFNU=
 github.com/dgraph-io/ristretto/v2 v2.1.0 h1:59LjpOJLNDULHh8MC4UaegN52lC4JnO2dITsie/Pa8I=
@@ -411,8 +411,8 @@ github.com/go-playground/locales v0.14.1 h1:EWaQ/wswjilfKLTECiXz7Rh+3BjFhfDFKv/o
 github.com/go-playground/locales v0.14.1/go.mod h1:hxrqLVvrK65+Rwrd5Fc6F2O76J/NuW9t0sjnWqG1slY=
 github.com/go-playground/universal-translator v0.18.1 h1:Bcnm0ZwsGyWbCzImXv+pAJnYK9S473LQFuzCbDbfSFY=
 github.com/go-playground/universal-translator v0.18.1/go.mod h1:xekY+UJKNuX9WP91TpwSH2VMlDf28Uj24BCp08ZFTUY=
-github.com/go-playground/validator/v10 v10.26.0 h1:SP05Nqhjcvz81uJaRfEV0YBSSSGMc/iMaVtFbr3Sw2k=
-github.com/go-playground/validator/v10 v10.26.0/go.mod h1:I5QpIEbmr8On7W0TktmJAumgzX4CA1XNl4ZmDuVHKKo=
+github.com/go-playground/validator/v10 v10.25.0 h1:5Dh7cjvzR7BRZadnsVOzPhWsrwUr0nmsZJxEAnFLNO8=
+github.com/go-playground/validator/v10 v10.25.0/go.mod h1:GGzBIJMuE98Ic/kJsBXbz1x/7cByt++cQ+YOuDM5wus=
 github.com/go-redis/redis/v8 v8.11.5 h1:AcZZR7igkdvfVmQTPnu9WE37LRrO/YrBH5zWyjDC0oI=
 github.com/go-redis/redis/v8 v8.11.5/go.mod h1:gREzHqY1hg6oD9ngVRbLStwAWKhA0FEgq8Jd4h5lpwo=
 github.com/go-resty/resty/v2 v2.1.1-0.20191201195748-d7b97669fe48/go.mod h1:dZGr0i9PLlaaTD4H/hoZIDjQ+r6xq8mgbRzHZf7f2J8=
@@ -504,8 +504,8 @@ github.com/gomodule/redigo v1.9.2 h1:HrutZBLhSIU8abiSfW8pj8mPhOyMYjZT/wcA4/L9L9s
 github.com/gomodule/redigo v1.9.2/go.mod h1:KsU3hiK/Ay8U42qpaJk+kuNa3C+spxapWpM+ywhcgtw=
 github.com/google/btree v0.0.0-20180813153112-4030bb1f1f0c/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ=
 github.com/google/btree v1.0.0/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ=
-github.com/google/flatbuffers v25.2.10+incompatible h1:F3vclr7C3HpB1k9mxCGRMXq6FdUalZ6H/pNX4FP1v0Q=
-github.com/google/flatbuffers v25.2.10+incompatible/go.mod h1:1AeVuKshWv4vARoZatz6mlQ0JxURH0Kv5+zNeJKJCa8=
+github.com/google/flatbuffers v24.12.23+incompatible h1:ubBKR94NR4pXUCY/MUsRVzd9umNW7ht7EG9hHfS9FX8=
+github.com/google/flatbuffers v24.12.23+incompatible/go.mod h1:1AeVuKshWv4vARoZatz6mlQ0JxURH0Kv5+zNeJKJCa8=
 github.com/google/go-cmp v0.2.0/go.mod h1:oXzfMopK8JAjlY9xF4vHSVASa0yLyX7SntLO5aqRK0M=
 github.com/google/go-cmp v0.3.0/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU=
 github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU=
@@ -540,8 +540,8 @@ github.com/google/pprof v0.0.0-20200212024743-f11f1df84d12/go.mod h1:ZgVRPoUq/hf
 github.com/google/pprof v0.0.0-20200229191704-1ebb73c60ed3/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
 github.com/google/pprof v0.0.0-20200430221834-fc25d7d30c6d/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
 github.com/google/pprof v0.0.0-20200708004538-1a94d8640e99/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
-github.com/google/pprof v0.0.0-20250403155104-27863c87afa6 h1:BHT72Gu3keYf3ZEu2J0b1vyeLSOYI8bm5wbJM/8yDe8=
-github.com/google/pprof v0.0.0-20250403155104-27863c87afa6/go.mod h1:boTsfXsheKC2y+lKOCMpSfarhxDeIzfZG1jqGcPl3cA=
+github.com/google/pprof v0.0.0-20241210010833-40e02aabc2ad h1:a6HEuzUHeKH6hwfN/ZoQgRgVIWFJljSWa/zetS2WTvg=
+github.com/google/pprof v0.0.0-20241210010833-40e02aabc2ad/go.mod h1:vavhavw2zAxS5dIdcRluK6cSGGPlZynqzFM8NdvU144=
 github.com/google/renameio v0.1.0/go.mod h1:KWCgfxg9yswjAJkECMjeO8J8rahYeXnNhOm40UhjYkI=
 github.com/google/renameio/v2 v2.0.0 h1:UifI23ZTGY8Tt29JbYFiuyIU3eX+RNFtUwefq9qAhxg=
 github.com/google/renameio/v2 v2.0.0/go.mod h1:BtmJXm5YlszgC+TD4HOEEUFgkJP3nLxehU6hfe7jRt4=
@@ -689,8 +689,8 @@ github.com/klauspost/compress v1.15.9/go.mod h1:PhcZ0MbTNciWF3rruxRgKxI5NkcHHrHU
 github.com/klauspost/compress v1.18.0 h1:c/Cqfb0r+Yi+JtIEq73FWXVkRonBlf0CRNYc8Zttxdo=
 github.com/klauspost/compress v1.18.0/go.mod h1:2Pp+KzxcywXVXMr50+X0Q/Lsb43OQHYWRCY2AiWywWQ=
 github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
-github.com/klauspost/cpuid/v2 v2.2.10 h1:tBs3QSyvjDyFTq3uoc/9xFpCuOsJQFNPiAhYdw2skhE=
-github.com/klauspost/cpuid/v2 v2.2.10/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0=
+github.com/klauspost/cpuid/v2 v2.2.9 h1:66ze0taIn2H33fBvCkXuv9BmCwDfafmiIVpKV9kKGuY=
+github.com/klauspost/cpuid/v2 v2.2.9/go.mod h1:rqkxqrZ1EhYM9G+hXH7YdowN5R5RGN6NK4QwQ3WMXF8=
 github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202 h1:A1xJ2NKgiYFiaHiLl9B5yw/gUBACSs9crDykTS3GuQI=
 github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202/go.mod h1:bHA7t77X/QFExdeAnDzK6vKM34kEZAcE1OX4MfiwjkE=
 github.com/kobergj/plugins/v4/store/nats-js-kv v0.0.0-20240807130109-f62bb67e8c90 h1:pfI8Z5yavO6fU6vDGlWhZ4BgDlvj8c6xB7J57HfTPwA=
@@ -768,8 +768,8 @@ github.com/mattn/go-runewidth v0.0.6/go.mod h1:H031xJmbD/WCDINGzjvQ9THkh0rPKHF+m
 github.com/mattn/go-runewidth v0.0.9/go.mod h1:H031xJmbD/WCDINGzjvQ9THkh0rPKHF+m2gUSrubnMI=
 github.com/mattn/go-runewidth v0.0.16 h1:E5ScNMtiwvlvB5paMFdw9p4kSQzbXFikJ5SQO6TULQc=
 github.com/mattn/go-runewidth v0.0.16/go.mod h1:Jdepj2loyihRzMpdS35Xk/zdY8IAYHsh153qUoGf23w=
-github.com/mattn/go-sqlite3 v1.14.27 h1:drZCnuvf37yPfs95E5jd9s3XhdVWLal+6BOK6qrv6IU=
-github.com/mattn/go-sqlite3 v1.14.27/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
+github.com/mattn/go-sqlite3 v1.14.24 h1:tpSp2G2KyMnnQu99ngJ47EIkWVmliIizyZBfPrBWDRM=
+github.com/mattn/go-sqlite3 v1.14.24/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
 github.com/mattn/go-tty v0.0.0-20180219170247-931426f7535a/go.mod h1:XPvLUNfbS4fJH25nqRHfWLMa1ONC8Amw+mIA639KxkE=
 github.com/mattn/go-tty v0.0.3/go.mod h1:ihxohKRERHTVzN+aSVRwACLCeqIoZAWpoICkkvrWyR0=
 github.com/matttproud/golang_protobuf_extensions v1.0.1/go.mod h1:D8He9yQNgCq6Z5Ld7szi9bcBfOoFv/3dc6xSMkL2PC0=
@@ -789,8 +789,8 @@ github.com/minio/highwayhash v1.0.3 h1:kbnuUMoHYyVl7szWjSxJnxw11k2U709jqFPPmIUyD
 github.com/minio/highwayhash v1.0.3/go.mod h1:GGYsuwP/fPD6Y9hMiXuapVvlIUEhFhMTh0rxU3ik1LQ=
 github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34=
 github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM=
-github.com/minio/minio-go/v7 v7.0.89 h1:hx4xV5wwTUfyv8LarhJAwNecnXpoTsj9v3f3q/ZkiJU=
-github.com/minio/minio-go/v7 v7.0.89/go.mod h1:2rFnGAp02p7Dddo1Fq4S2wYOfpF0MUTSeLTRC90I204=
+github.com/minio/minio-go/v7 v7.0.88 h1:v8MoIJjwYxOkehp+eiLIuvXk87P2raUtoU5klrAAshs=
+github.com/minio/minio-go/v7 v7.0.88/go.mod h1:33+O8h0tO7pCeCWwBVa07RhVVfB/3vS4kEX7rwYKmIg=
 github.com/mitchellh/cli v1.0.0/go.mod h1:hNIlj7HEI86fIcpObd7a0FcrxTWetlwJDGcceTlRvqc=
 github.com/mitchellh/copystructure v1.2.0 h1:vpKXTN4ewci03Vljg/q9QvCGUDttBOGBIa15WveJJGw=
 github.com/mitchellh/copystructure v1.2.0/go.mod h1:qLl+cE2AmVv+CoeAwDPye/v+N2HKCj9FbZEVFJRxO9s=
@@ -827,8 +827,8 @@ github.com/mwitkow/go-conntrack v0.0.0-20190716064945-2f068394615f/go.mod h1:qRW
 github.com/namedotcom/go v0.0.0-20180403034216-08470befbe04/go.mod h1:5sN+Lt1CaY4wsPvgQH/jsuJi4XO2ssZbdsIizr4CVC8=
 github.com/nats-io/jwt/v2 v2.7.3 h1:6bNPK+FXgBeAqdj4cYQ0F8ViHRbi7woQLq4W29nUAzE=
 github.com/nats-io/jwt/v2 v2.7.3/go.mod h1:GvkcbHhKquj3pkioy5put1wvPxs78UlZ7D/pY+BgZk4=
-github.com/nats-io/nats-server/v2 v2.11.0 h1:fdwAT1d6DZW/4LUz5rkvQUe5leGEwjjOQYntzVRKvjE=
-github.com/nats-io/nats-server/v2 v2.11.0/go.mod h1:leXySghbdtXSUmWem8K9McnJ6xbJOb0t9+NQ5HTRZjI=
+github.com/nats-io/nats-server/v2 v2.11.1 h1:LwdauqMqMNhTxTN3+WFTX6wGDOKntHljgZ+7gL5HCnk=
+github.com/nats-io/nats-server/v2 v2.11.1/go.mod h1:leXySghbdtXSUmWem8K9McnJ6xbJOb0t9+NQ5HTRZjI=
 github.com/nats-io/nats.go v1.41.0 h1:PzxEva7fflkd+n87OtQTXqCTyLfIIMFJBpyccHLE2Ko=
 github.com/nats-io/nats.go v1.41.0/go.mod h1:wV73x0FSI/orHPSYoyMeJB+KajMDoWyXmFaRrrYaaTo=
 github.com/nats-io/nkeys v0.4.10 h1:glmRrpCmYLHByYcePvnTBEAwawwapjCPMjy2huw20wc=
@@ -856,17 +856,17 @@ github.com/onsi/ginkgo v1.7.0/go.mod h1:lLunBs/Ym6LB5Z9jYTR76FiuTmxDTDusOGeTQH+W
 github.com/onsi/ginkgo v1.12.1/go.mod h1:zj2OWP4+oCPe1qIXoGWkgMRwljMUYCdkwsT2108oapk=
 github.com/onsi/ginkgo v1.16.5 h1:8xi0RTUf59SOSfEtZMvwTvXYMzG4gV23XVHOZiXNtnE=
 github.com/onsi/ginkgo v1.16.5/go.mod h1:+E8gABHa3K6zRBolWtd+ROzc/U5bkGt0FwiG042wbpU=
-github.com/onsi/ginkgo/v2 v2.23.4 h1:ktYTpKJAVZnDT4VjxSbiBenUjmlL/5QkBEocaWXiQus=
-github.com/onsi/ginkgo/v2 v2.23.4/go.mod h1:Bt66ApGPBFzHyR+JO10Zbt0Gsp4uWxu5mIOTusL46e8=
+github.com/onsi/ginkgo/v2 v2.23.3 h1:edHxnszytJ4lD9D5Jjc4tiDkPBZ3siDeJJkUZJJVkp0=
+github.com/onsi/ginkgo/v2 v2.23.3/go.mod h1:zXTP6xIp3U8aVuXN8ENK9IXRaTjFnpVB9mGmaSRvxnM=
 github.com/onsi/gomega v1.4.3/go.mod h1:ex+gbHU/CVuBBDIJjb2X0qEXbFg53c61hWP/1CpauHY=
 github.com/onsi/gomega v1.7.1/go.mod h1:XdKZgCCFLUoM/7CFJVPcG8C1xQ1AJ0vpAezJrB7JYyY=
 github.com/onsi/gomega v1.10.1/go.mod h1:iN09h71vgCQne3DLsj+A5owkum+a2tYe+TOCB1ybHNo=
-github.com/onsi/gomega v1.37.0 h1:CdEG8g0S133B4OswTDC/5XPSzE1OeP29QOioj2PID2Y=
-github.com/onsi/gomega v1.37.0/go.mod h1:8D9+Txp43QWKhM24yyOBEdpkzN8FvJyAwecBgsU4KU0=
-github.com/open-policy-agent/opa v1.3.0 h1:zVvQvQg+9+FuSRBt4LgKNzJwsWl/c85kD5jPozJTydY=
-github.com/open-policy-agent/opa v1.3.0/go.mod h1:t9iPNhaplD2qpiBqeudzJtEX3fKHK8zdA29oFvofAHo=
-github.com/opencloud-eu/reva/v2 v2.31.0 h1:UVgeb0hSPoaDdqcKSJ7XZAhXCtHaVK9qm/JtFtJM/7U=
-github.com/opencloud-eu/reva/v2 v2.31.0/go.mod h1:8MT1a/WJASZZhlSMC0oeE3ECQdjqFw3BUiiAIZ/JR8I=
+github.com/onsi/gomega v1.36.3 h1:hID7cr8t3Wp26+cYnfcjR6HpJ00fdogN6dqZ1t6IylU=
+github.com/onsi/gomega v1.36.3/go.mod h1:8D9+Txp43QWKhM24yyOBEdpkzN8FvJyAwecBgsU4KU0=
+github.com/open-policy-agent/opa v1.2.0 h1:88NDVCM0of1eO6Z4AFeL3utTEtMuwloFmWWU7dRV1z0=
+github.com/open-policy-agent/opa v1.2.0/go.mod h1:30euUmOvuBoebRCcJ7DMF42bRBOPznvt0ACUMYDUGVY=
+github.com/opencloud-eu/reva/v2 v2.29.4 h1:UaykCqG3FNEpaeZzixsJBGi+j/Ihl3qASQ1WgcYTDb0=
+github.com/opencloud-eu/reva/v2 v2.29.4/go.mod h1:+nkCU7w6E6cyNSsKRYj1rb0cCI7QswEQ7KOPljctebM=
 github.com/opentracing/opentracing-go v1.1.0/go.mod h1:UkNAQd3GIcIGf0SeVgPpRdFStlNbqXla1AfSYxPUl2o=
 github.com/opentracing/opentracing-go v1.2.0 h1:uEJPy/1a5RIPAJ0Ov+OIO8OxWu77jEv+1B0VhjKrZUs=
 github.com/opentracing/opentracing-go v1.2.0/go.mod h1:GxEUsuufX4nBwe+T+Wl9TAgYrxe9dPLANfrWvHYVTgc=
@@ -911,8 +911,6 @@ github.com/posener/complete v1.1.1/go.mod h1:em0nMJCgc9GFtwrmVmEMR/ZL6WyhyjMBndr
 github.com/pquerna/cachecontrol v0.2.0 h1:vBXSNuE5MYP9IJ5kjsdo8uq+w41jSPgvba2DEnkRx9k=
 github.com/pquerna/cachecontrol v0.2.0/go.mod h1:NrUG3Z7Rdu85UNR3vm7SOsl1nFIeSiQnrHV5K9mBcUI=
 github.com/pquerna/otp v1.3.0/go.mod h1:dkJfzwRKNiegxyNb54X/3fLwhCynbMspSyWKnvi1AEg=
-github.com/prashantv/gostub v1.1.0 h1:BTyx3RfQjRHnUWaGF9oQos79AlQ5k8WNktv7VGvVH4g=
-github.com/prashantv/gostub v1.1.0/go.mod h1:A5zLQHz7ieHGG7is6LLXLz7I8+3LZzsrV0P1IAHhP5U=
 github.com/prometheus/alertmanager v0.28.1 h1:BK5pCoAtaKg01BYRUJhEDV1tqJMEtYBGzPw8QdvnnvA=
 github.com/prometheus/alertmanager v0.28.1/go.mod h1:0StpPUDDHi1VXeM7p2yYfeZgLVi/PPlt39vo9LQUHxM=
 github.com/prometheus/client_golang v0.8.0/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXPKyh/dDVn+NZz0KFw=
@@ -1100,13 +1098,13 @@ github.com/toorop/go-dkim v0.0.0-20201103131630-e1cd1a0a5208/go.mod h1:BzWtXXrXz
 github.com/transip/gotransip/v6 v6.2.0/go.mod h1:pQZ36hWWRahCUXkFWlx9Hs711gLd8J4qdgLdRzmtY+g=
 github.com/trustelem/zxcvbn v1.0.1 h1:mp4JFtzdDYGj9WYSD3KQSkwwUumWNFzXaAjckaTYpsc=
 github.com/trustelem/zxcvbn v1.0.1/go.mod h1:zonUyKeh7sw6psPf/e3DtRqkRyZvAbOfjNz/aO7YQ5s=
-github.com/tus/tusd/v2 v2.8.0 h1:X2jGxQ05jAW4inDd2ogmOKqwnb4c/D0lw2yhgHayWyU=
-github.com/tus/tusd/v2 v2.8.0/go.mod h1:3/zEOVQQIwmJhvNam8phV4x/UQt68ZmZiTzeuJUNhVo=
+github.com/tus/tusd/v2 v2.7.1 h1:TGJjhv9RYXDmsTz8ug/qSd9vQpmD0Ik0G0IPo80Qmc0=
+github.com/tus/tusd/v2 v2.7.1/go.mod h1:PLdIMQ/ge+5ADgGKcL3FgTaPs+7wB0JIiI5HQXAiJE8=
 github.com/uber-go/atomic v1.3.2/go.mod h1:/Ct5t2lcmbJ4OSe/waGBoaVvVqtO0bmtfVNex1PFV8g=
 github.com/urfave/cli v1.22.4/go.mod h1:Gos4lmkARVdJ6EkW0WaNv/tZAAMe9V7XWyB60NtXRu0=
 github.com/urfave/cli/v2 v2.3.0/go.mod h1:LJmUH05zAU44vOAcrfzZQKsZbVcdbOG8rtL3/XcUArI=
-github.com/urfave/cli/v2 v2.27.6 h1:VdRdS98FNhKZ8/Az8B7MTyGQmpIr36O1EHybx/LaZ4g=
-github.com/urfave/cli/v2 v2.27.6/go.mod h1:3Sevf16NykTbInEnD0yKkjDAeZDS0A6bzhBH5hrMvTQ=
+github.com/urfave/cli/v2 v2.27.5 h1:WoHEJLdsXr6dDWoJgMq/CboDmyY/8HMMH1fTECbih+w=
+github.com/urfave/cli/v2 v2.27.5/go.mod h1:3Sevf16NykTbInEnD0yKkjDAeZDS0A6bzhBH5hrMvTQ=
 github.com/valyala/bytebufferpool v1.0.0/go.mod h1:6bBcMArwyJ5K/AmCkWv1jt77kVWyCJ6HpOuEn7z0Csc=
 github.com/valyala/fasttemplate v1.0.1/go.mod h1:UQGH1tvbgY+Nz5t2n7tXsz52dQxojPUpymEIMZ47gx8=
 github.com/valyala/fasttemplate v1.1.0/go.mod h1:UQGH1tvbgY+Nz5t2n7tXsz52dQxojPUpymEIMZ47gx8=
@@ -1179,8 +1177,6 @@ go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.35.0 h1:1fTNlAIJZGWLP5FVu0f
 go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.35.0/go.mod h1:zjPK58DtkqQFn+YUMbx0M2XV3QgKU0gS9LeGohREyK4=
 go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.35.0 h1:m639+BofXTvcY1q8CGs4ItwQarYtJPOWmVobfM1HpVI=
 go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.35.0/go.mod h1:LjReUci/F4BUyv+y4dwnq3h/26iNOeC3wAIqgvTIZVo=
-go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp v1.35.0 h1:xJ2qHD0C1BeYVTLLR9sX12+Qb95kfeD/byKj6Ky1pXg=
-go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp v1.35.0/go.mod h1:u5BF1xyjstDowA1R5QAO9JHzqK+ublenEW/dyqTjBVk=
 go.opentelemetry.io/otel/metric v1.35.0 h1:0znxYu2SNyuMSQT4Y9WDWej0VpcsxkuklLa4/siN90M=
 go.opentelemetry.io/otel/metric v1.35.0/go.mod h1:nKVFgxBZ2fReX6IlyW28MgZojkoAkJGaE8CpgeAU3oE=
 go.opentelemetry.io/otel/sdk v1.35.0 h1:iPctf8iprVySXSKJffSS79eOjl9pvxV9ZqOWT0QejKY=
@@ -1196,8 +1192,6 @@ go.uber.org/atomic v1.4.0/go.mod h1:gD2HeocX3+yG+ygLZcrzQJaqmWj9AIm7n08wl/qW/PE=
 go.uber.org/atomic v1.7.0/go.mod h1:fEN4uk6kAWBTFdckzkM89CLk9XfWZrxpCo0nPH17wJc=
 go.uber.org/atomic v1.11.0 h1:ZvwS0R+56ePWxUNi+Atn9dWONBPp/AUETXlHW0DxSjE=
 go.uber.org/atomic v1.11.0/go.mod h1:LUxbIzbOniOlMKjJjyPfpl4v+PKK2cNJn91OQbhoJI0=
-go.uber.org/automaxprocs v1.6.0 h1:O3y2/QNTOdbF+e/dpXNNW7Rx2hZ4sTIPyybbxyNqTUs=
-go.uber.org/automaxprocs v1.6.0/go.mod h1:ifeIMSnPZuznNm6jmdzmU3/bfk01Fe2fotchwEFJ8r8=
 go.uber.org/goleak v1.1.10/go.mod h1:8a7PlsEVH3e/a/GLqe5IIrQx6GzcnRmZEufDUTk4A7A=
 go.uber.org/goleak v1.3.0 h1:2K3zAYmnTNqV73imy9J1T3WC+gmCePx2hEGkimedGto=
 go.uber.org/goleak v1.3.0/go.mod h1:CoHD4mav9JJNrW/WLlf7HGZPjdw8EucARQHekz1X6bE=
@@ -1334,8 +1328,8 @@ golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
 golang.org/x/net v0.23.0/go.mod h1:JKghWKKOSdJwpW2GEx0Ja7fmaKnMsbu+MWVZTokSYmg=
 golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
 golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
-golang.org/x/net v0.38.0 h1:vRMAPTMaeGqVhG5QyLJHqNDwecKTomGeqbnfZyKlBI8=
-golang.org/x/net v0.38.0/go.mod h1:ivrbrMbzFq5J41QOQh0siUuly180yBYtLp+CKbEaFx8=
+golang.org/x/net v0.37.0 h1:1zLorHbz+LYj7MQlSf1+2tPIIgibq2eL5xkrGk6f+2c=
+golang.org/x/net v0.37.0/go.mod h1:ivrbrMbzFq5J41QOQh0siUuly180yBYtLp+CKbEaFx8=
 golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U=
 golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
 golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
@@ -1446,8 +1440,8 @@ golang.org/x/sys v0.18.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.21.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
-golang.org/x/sys v0.32.0 h1:s77OFDvIQeibCmezSnk/q6iAfkdiQaJi4VzroCFrN20=
-golang.org/x/sys v0.32.0/go.mod h1:BJP2sWEmIv4KK5OTEluFJCKSidICx8ciO85XgH3Ak8k=
+golang.org/x/sys v0.31.0 h1:ioabZlmFYtWhL+TRYpcnNlLwhyxaM9kWTDEmfnprqik=
+golang.org/x/sys v0.31.0/go.mod h1:BJP2sWEmIv4KK5OTEluFJCKSidICx8ciO85XgH3Ak8k=
 golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
 golang.org/x/term v0.0.0-20201117132131-f5c789dd3221/go.mod h1:Nr5EML6q2oocZ2LXRh80K7BxOlk5/8JxuGnuhpl+muw=
 golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
@@ -1603,8 +1597,8 @@ google.golang.org/genproto v0.0.0-20200618031413-b414f8b61790/go.mod h1:jDfRM7Fc
 google.golang.org/genproto v0.0.0-20200729003335-053ba62fc06f/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
 google.golang.org/genproto v0.0.0-20200804131852-c06518451d9c/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
 google.golang.org/genproto v0.0.0-20200825200019-8632dd797987/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
-google.golang.org/genproto v0.0.0-20250303144028-a0af3efb3deb h1:ITgPrl429bc6+2ZraNSzMDk3I95nmQln2fuPstKwFDE=
-google.golang.org/genproto v0.0.0-20250303144028-a0af3efb3deb/go.mod h1:sAo5UzpjUwgFBCzupwhcLcxHVDK7vG5IqI30YnwX2eE=
+google.golang.org/genproto v0.0.0-20241118233622-e639e219e697 h1:ToEetK57OidYuqD4Q5w+vfEnPvPpuTwedCNVohYJfNk=
+google.golang.org/genproto v0.0.0-20241118233622-e639e219e697/go.mod h1:JJrvXBWRZaFMxBufik1a4RpFw4HhgVtBBWQeQgUj2cc=
 google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb h1:p31xT4yrYrSM/G4Sn2+TNUkVhFCbG9y8itM2S6Th950=
 google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb/go.mod h1:jbe3Bkdp+Dh2IrslsFCklNhweNTBgSYanP1UXhJDhKg=
 google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb h1:TLPQVbx1GJ8VKZxz52VAxl1EBgKXXbTiU9Fc5fZeLn4=
@@ -1624,8 +1618,8 @@ google.golang.org/grpc v1.29.1/go.mod h1:itym6AZVZYACWQqET3MqgPpjcuV5QH3BxFS3Iji
 google.golang.org/grpc v1.30.0/go.mod h1:N36X2cJ7JwdamYAgDz+s+rVMFjt3numwzf/HckM8pak=
 google.golang.org/grpc v1.31.0/go.mod h1:N36X2cJ7JwdamYAgDz+s+rVMFjt3numwzf/HckM8pak=
 google.golang.org/grpc v1.33.2/go.mod h1:JMHMWHQWaTccqQQlmk3MJZS+GWXOdAesneDmEnv2fbc=
-google.golang.org/grpc v1.71.1 h1:ffsFWr7ygTUscGPI0KKK6TLrGz0476KUvvsbqWK0rPI=
-google.golang.org/grpc v1.71.1/go.mod h1:H0GRtasmQOh9LkFoCPDu3ZrwUtD1YGE+b2vYBYd/8Ec=
+google.golang.org/grpc v1.71.0 h1:kF77BGdPTQ4/JZWMlb9VpJ5pa25aqvVqogsxNHHdeBg=
+google.golang.org/grpc v1.71.0/go.mod h1:H0GRtasmQOh9LkFoCPDu3ZrwUtD1YGE+b2vYBYd/8Ec=
 google.golang.org/grpc/examples v0.0.0-20211102180624-670c133e568e h1:m7aQHHqd0q89mRwhwS9Bx2rjyl/hsFAeta+uGrHsQaU=
 google.golang.org/grpc/examples v0.0.0-20211102180624-670c133e568e/go.mod h1:gID3PKrg7pWKntu9Ss6zTLJ0ttC0X9IHgREOCZwbCVU=
 google.golang.org/protobuf v0.0.0-20200109180630-ec00e32a8dfd/go.mod h1:DFci5gLYBciE7Vtevhsrf46CRTquxDuWsQurQQe4oz8=
@@ -1642,8 +1636,8 @@ google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp0
 google.golang.org/protobuf v1.26.0/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc=
 google.golang.org/protobuf v1.28.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
 google.golang.org/protobuf v1.28.1/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
-google.golang.org/protobuf v1.36.6 h1:z1NpPI8ku2WgiWnf+t9wTPsn6eP1L7ksHUlkfLvd9xY=
-google.golang.org/protobuf v1.36.6/go.mod h1:jduwjTPXsFjZGTmRluh+L6NjiWu7pchiJ2/5YcXBHnY=
+google.golang.org/protobuf v1.36.5 h1:tPhr+woSbjfYvY6/GPufUoYizxw1cF/yFoxJ2fmpwlM=
+google.golang.org/protobuf v1.36.5/go.mod h1:9fA7Ob0pmnwhb644+1+CVWFRbNajQ6iRojtC/QF5bRE=
 gopkg.in/alecthomas/kingpin.v2 v2.2.6/go.mod h1:FMv+mEhP44yOT+4EoQTLFTRgOQ1FBLkstjWtayDeSgw=
 gopkg.in/cenkalti/backoff.v1 v1.1.0 h1:Arh75ttbsvlpVA7WtVpH4u9h6Zl46xuptxqLxPiSo4Y=
 gopkg.in/cenkalti/backoff.v1 v1.1.0/go.mod h1:J6Vskwqd+OMVJl8C33mmtxTBs2gyzfv7UDAkHu8BrjI=

pkg/kql/dictionary_gen.go

@@ -2716,7 +2716,7 @@ var (
 
 	// errMaxExprCnt is used to signal that the maximum number of
 	// expressions have been parsed.
-	errMaxExprCnt = errors.New("max number of expressions parsed")
+	errMaxExprCnt = errors.New("max number of expresssions parsed")
 )
 
 // Option is a function that can set an option on the parser. It returns

pkg/oidc/mocks/oidc_client.go

@@ -1,4 +1,4 @@
-// Code generated by mockery v2.53.2. DO NOT EDIT.
+// Code generated by mockery v2.53.0. DO NOT EDIT.
 
 package mocks
 

pkg/version/version.go

@@ -16,7 +16,7 @@ var (
 	// LatestTag is the latest released version plus the dev meta version.
 	// Will be overwritten by the release pipeline
 	// Needs a manual change for every tagged release
-	LatestTag = "2.1.0+dev"
+	LatestTag = "2.0.1+dev"
 
 	// Date indicates the build date.
 	// This has been removed, it looks like you can only replace static strings with recent go versions
@@ -46,17 +46,18 @@ func GetString() string {
 // Parsed returns a semver Version
 func Parsed() (version *semver.Version) {
 	versionToParse := LatestTag
-	// use the placeholder version if the tag is empty or when we are creating a daily build
-	if Tag != "" && Tag != "daily" {
+	if Tag != "" {
 		versionToParse = Tag
 	}
 	version, err := semver.NewVersion(versionToParse)
+	// We have no semver version but a commitid
 	if err != nil {
 		// this should never happen
-		return &semver.Version{}
+		if err != nil {
+			return &semver.Version{}
+		}
 	}
 	if String != "" {
-		// We have no tagged version but a commitid
 		nVersion, err := version.SetMetadata(String)
 		if err != nil {
 			return &semver.Version{}

services/antivirus/README.md

@@ -33,17 +33,11 @@ See the environment variables for more details.
 ### Maximum Scan Size
 
 Several factors can make it necessary to limit the maximum filesize the antivirus service uses for scanning.
-Use the `ANTIVIRUS_MAX_SCAN_SIZE` environment variable to scan only a given number of bytes,
-or to skip the whole resource.
+Use the `ANTIVIRUS_MAX_SCAN_SIZE` environment variable to specify the maximum file size to be scanned.
 
-Even if it's recommended to scan the whole file, several factors like scanner type and version,
+Even if it's recommended to scan each file, several factors like scanner type and version,
 bandwidth, performance issues, etc. might make a limit necessary.
 
-In such cases, the antivirus the max scan size mode can be handy, the following modes are available:
-
-  -   `partial`: The file is scanned up to the given size. The rest of the file is not scanned. This is the default mode `ANTIVIRUS_MAX_SCAN_SIZE=partial`
-  -   `skip`: The file is skipped and not scanned. `ANTIVIRUS_MAX_SCAN_SIZE=skip`
-
 **IMPORTANT**
 > Streaming of files to the virus scan service still [needs to be implemented](https://github.com/owncloud/ocis/issues/6803).
 > To prevent OOM errors `ANTIVIRUS_MAX_SCAN_SIZE` needs to be set lower than available ram and or the maximum file size that can be scanned by the virus scanner.

services/antivirus/pkg/command/server.go

@@ -45,7 +45,7 @@ func Server(cfg *config.Config) *cli.Command {
 			{
 				svc, err := service.NewAntivirus(cfg, logger, traceProvider)
 				if err != nil {
-					return cli.Exit(err.Error(), 1)
+					return err
 				}
 
 				gr.Add(svc.Run, func(_ error) {

services/antivirus/pkg/config/config.go

@@ -5,26 +5,6 @@ import (
 	"time"
 )
 
-// ScannerType gives info which scanner is used
-type ScannerType string
-
-const (
-	// ScannerTypeClamAV defines that clamav is used
-	ScannerTypeClamAV ScannerType = "clamav"
-	// ScannerTypeICap defines that icap is used
-	ScannerTypeICap ScannerType = "icap"
-)
-
-// MaxScanSizeMode defines the mode of handling files that exceed the maximum scan size
-type MaxScanSizeMode string
-
-const (
-	// MaxScanSizeModeSkip defines that files that are bigger than the max scan size will be skipped
-	MaxScanSizeModeSkip MaxScanSizeMode = "skip"
-	// MaxScanSizeModePartial defines that only the file up to the max size will be used
-	MaxScanSizeModePartial MaxScanSizeMode = "partial"
-)
-
 // Config combines all available configuration parts.
 type Config struct {
 	File string
@@ -40,9 +20,8 @@ type Config struct {
 	Events               Events
 	Workers              int `yaml:"workers" env:"ANTIVIRUS_WORKERS" desc:"The number of concurrent go routines that fetch events from the event queue." introductionVersion:"1.0.0"`
 
-	Scanner         Scanner
-	MaxScanSize     string          `yaml:"max-scan-size" env:"ANTIVIRUS_MAX_SCAN_SIZE" desc:"The maximum scan size the virus scanner can handle.0 means unlimited. Usable common abbreviations: [KB, KiB, MB, MiB, GB, GiB, TB, TiB, PB, PiB, EB, EiB], example: 2GB." introductionVersion:"1.0.0"`
-	MaxScanSizeMode MaxScanSizeMode `yaml:"max-scan-size-mode" env:"ANTIVIRUS_MAX_SCAN_SIZE_MODE" desc:"Defines the mode of handling files that exceed the maximum scan size. Supported options are: 'skip', which skips files that are bigger than the max scan size, and 'truncate' (default), which only uses the file up to the max size." introductionVersion:"2.1.0"`
+	Scanner     Scanner
+	MaxScanSize string `yaml:"max-scan-size" env:"ANTIVIRUS_MAX_SCAN_SIZE" desc:"The maximum scan size the virus scanner can handle. 0 means unlimited. Usable common abbreviations: [KB, KiB, MB, MiB, GB, GiB, TB, TiB, PB, PiB, EB, EiB], example: 2GB." introductionVersion:"1.0.0"`
 
 	Context context.Context `json:"-" yaml:"-"`
 
@@ -83,7 +62,7 @@ type Events struct {
 
 // Scanner provides configuration options for the virus scanner
 type Scanner struct {
-	Type ScannerType `yaml:"type" env:"ANTIVIRUS_SCANNER_TYPE" desc:"The antivirus scanner to use. Supported values are 'clamav' and 'icap'." introductionVersion:"1.0.0"`
+	Type string `yaml:"type" env:"ANTIVIRUS_SCANNER_TYPE" desc:"The antivirus scanner to use. Supported values are 'clamav' and 'icap'." introductionVersion:"1.0.0"`
 
 	ClamAV ClamAV // only if Type == clamav
 	ICAP   ICAP   // only if Type == icap
@@ -91,8 +70,7 @@ type Scanner struct {
 
 // ClamAV provides configuration option for clamav
 type ClamAV struct {
-	Socket  string        `yaml:"socket" env:"ANTIVIRUS_CLAMAV_SOCKET" desc:"The socket clamav is running on. Note the default value is an example which needs adaption according your OS." introductionVersion:"1.0.0"`
-	Timeout time.Duration `yaml:"scan_timeout" env:"ANTIVIRUS_CLAMAV_SCAN_TIMEOUT" desc:"Scan timeout for the ClamAV client. Defaults to '5m' (5 minutes). See the Environment Variable Types description for more details." introductionVersion:"2.1.0"`
+	Socket string `yaml:"socket" env:"ANTIVIRUS_CLAMAV_SOCKET" desc:"The socket clamav is running on. Note the default value is an example which needs adaption according your OS." introductionVersion:"1.0.0"`
 }
 
 // ICAP provides configuration options for icap

services/antivirus/pkg/config/defaults/defaultconfig.go

@@ -30,15 +30,10 @@ func DefaultConfig() *config.Config {
 		},
 		Workers:              10,
 		InfectedFileHandling: "delete",
-		// defaults from clamav sample conf: MaxScanSize=400M, MaxFileSize=100M, StreamMaxLength=100M
-		// https://github.com/Cisco-Talos/clamav/blob/main/etc/clamd.conf.sample
-		MaxScanSize:     "100MB",
-		MaxScanSizeMode: config.MaxScanSizeModePartial,
 		Scanner: config.Scanner{
-			Type: config.ScannerTypeClamAV,
+			Type: "clamav",
 			ClamAV: config.ClamAV{
-				Socket:  "/run/clamav/clamd.ctl",
-				Timeout: 5 * time.Minute,
+				Socket: "/run/clamav/clamd.ctl",
 			},
 			ICAP: config.ICAP{
 				URL:     "icap://127.0.0.1:1344",
@@ -62,9 +57,4 @@ func EnsureDefaults(cfg *config.Config) {
 
 // Sanitize sanitizes the configuration
 func Sanitize(cfg *config.Config) {
-	defaultConfig := DefaultConfig()
-
-	if cfg.MaxScanSize == "" {
-		cfg.MaxScanSize = defaultConfig.MaxScanSize
-	}
 }

services/antivirus/pkg/scanners/clamav.go

@@ -1,51 +1,34 @@
 package scanners
 
 import (
-	"fmt"
 	"time"
 
 	"github.com/dutchcoders/go-clamd"
 )
 
 // NewClamAV returns a Scanner talking to clamAV via socket
-func NewClamAV(socket string, timeout time.Duration) (*ClamAV, error) {
-	c := clamd.NewClamd(socket)
-
-	if err := c.Ping(); err != nil {
-		return nil, fmt.Errorf("%w: %w", ErrScannerNotReachable, err)
-	}
-
+func NewClamAV(socket string) *ClamAV {
 	return &ClamAV{
-		clamd:   clamd.NewClamd(socket),
-		timeout: timeout,
-	}, nil
+		clamd: clamd.NewClamd(socket),
+	}
 }
 
 // ClamAV is a Scanner based on clamav
 type ClamAV struct {
-	clamd   *clamd.Clamd
-	timeout time.Duration
+	clamd *clamd.Clamd
 }
 
 // Scan to fulfill Scanner interface
 func (s ClamAV) Scan(in Input) (Result, error) {
-	abort := make(chan bool, 1)
-	defer close(abort)
-
-	ch, err := s.clamd.ScanStream(in.Body, abort)
+	ch, err := s.clamd.ScanStream(in.Body, make(chan bool))
 	if err != nil {
 		return Result{}, err
 	}
 
-	select {
-	case <-time.After(s.timeout):
-		abort <- true
-		return Result{}, fmt.Errorf("%w: %s", ErrScanTimeout, in.Url)
-	case s := <-ch:
-		return Result{
-			Infected:    s.Status == clamd.RES_FOUND,
-			Description: s.Description,
-			ScanTime:    time.Now(),
-		}, nil
-	}
+	r := <-ch
+	return Result{
+		Infected:    r.Status == clamd.RES_FOUND,
+		Description: r.Description,
+		ScanTime:    time.Now(),
+	}, nil
 }

services/antivirus/pkg/scanners/clamav_test.go

@@ -1,120 +0,0 @@
-package scanners_test
-
-import (
-	"context"
-	"net"
-	"os"
-	"path/filepath"
-	"strings"
-	"testing"
-	"time"
-
-	"github.com/stretchr/testify/assert"
-	"github.com/stretchr/testify/require"
-
-	"github.com/opencloud-eu/opencloud/services/antivirus/pkg/scanners"
-)
-
-func newUnixListener(t testing.TB, lc net.ListenConfig, v ...string) net.Listener {
-	d, err := os.MkdirTemp("", "")
-	assert.NoError(t, err)
-	t.Cleanup(func() {
-		require.NoError(t, os.RemoveAll(d))
-	})
-
-	nl, err := lc.Listen(context.Background(), "unix", filepath.Join(d, "sock"))
-	require.NoError(t, err)
-
-	go func() {
-		i := 0
-		for {
-			if len(v) == i {
-				break
-			}
-
-			conn, err := nl.Accept()
-			require.NoError(t, err)
-
-			time.Sleep(100 * time.Millisecond)
-
-			_, err = conn.Write([]byte(v[i]))
-			require.NoError(t, err)
-			require.NoError(t, conn.Close())
-			i++
-		}
-	}()
-
-	return nl
-}
-
-func TestNewClamAV(t *testing.T) {
-	t.Run("returns a scanner", func(t *testing.T) {
-		ul := newUnixListener(t, net.ListenConfig{}, "PONG\n")
-		defer func() {
-			assert.NoError(t, ul.Close())
-		}()
-
-		done := make(chan bool, 1)
-
-		go func() {
-			_, err := scanners.NewClamAV(ul.Addr().String(), 10*time.Second)
-			assert.NoError(t, err)
-			done <- true
-		}()
-
-		assert.True(t, <-done)
-	})
-
-	t.Run("fails if scanner is not pingable", func(t *testing.T) {
-		_, err := scanners.NewClamAV("", 0)
-		assert.ErrorIs(t, err, scanners.ErrScannerNotReachable)
-	})
-}
-
-func TestNewClamAV_Scan(t *testing.T) {
-	t.Run("returns a result", func(t *testing.T) {
-		ul := newUnixListener(t, net.ListenConfig{}, "PONG\n", "stream: Win.Test.EICAR_HDB-1 FOUND\n")
-		defer func() {
-			assert.NoError(t, ul.Close())
-		}()
-
-		done := make(chan bool, 1)
-
-		go func() {
-			scanner, err := scanners.NewClamAV(ul.Addr().String(), 10*time.Second)
-			assert.NoError(t, err)
-
-			result, err := scanner.Scan(scanners.Input{Body: strings.NewReader("DATA")})
-			assert.NoError(t, err)
-
-			assert.Equal(t, result.Description, "Win.Test.EICAR_HDB-1")
-			assert.True(t, result.Infected)
-			done <- true
-		}()
-
-		assert.True(t, <-done)
-	})
-
-	t.Run("aborts after a certain time", func(t *testing.T) {
-		ul := newUnixListener(t, net.ListenConfig{}, "PONG\n", "stream: Win.Test.EICAR_HDB-1 FOUND\n")
-		defer func() {
-			assert.NoError(t, ul.Close())
-		}()
-
-		done := make(chan bool, 1)
-
-		go func() {
-			scanner, err := scanners.NewClamAV(ul.Addr().String(), 10*time.Second)
-			assert.NoError(t, err)
-
-			result, err := scanner.Scan(scanners.Input{Body: strings.NewReader("DATA")})
-			assert.NoError(t, err)
-
-			assert.Equal(t, result.Description, "Win.Test.EICAR_HDB-1")
-			assert.True(t, result.Infected)
-			done <- true
-		}()
-
-		assert.True(t, <-done)
-	})
-}

services/antivirus/pkg/scanners/scanners.go

@@ -1,31 +1,21 @@
 package scanners
 
 import (
-	"errors"
 	"io"
 	"time"
 )
 
-var (
-	// ErrScanTimeout is returned when a scan times out
-	ErrScanTimeout = errors.New("time out waiting for clamav to respond while scanning")
-	// ErrScannerNotReachable is returned when the scanner is not reachable
-	ErrScannerNotReachable = errors.New("failed to reach the scanner")
-)
+// The Result is the common scan result to all scanners
+type Result struct {
+	Infected    bool
+	ScanTime    time.Time
+	Description string
+}
 
-type (
-	// The Result is the common scan result to all scanners
-	Result struct {
-		Infected    bool
-		ScanTime    time.Time
-		Description string
-	}
-
-	// The Input is the common input to all scanners
-	Input struct {
-		Body io.Reader
-		Size int64
-		Url  string
-		Name string
-	}
-)
+// The Input is the common input to all scanners
+type Input struct {
+	Body io.Reader
+	Size int64
+	Url  string
+	Name string
+}

services/antivirus/pkg/service/service.go

@@ -9,7 +9,6 @@ import (
 	"io"
 	"net/http"
 	"os"
-	"slices"
 	"sync"
 	"time"
 
@@ -38,44 +37,38 @@ type Scanner interface {
 }
 
 // NewAntivirus returns a service implementation for Service.
-func NewAntivirus(cfg *config.Config, logger log.Logger, tracerProvider trace.TracerProvider) (Antivirus, error) {
+func NewAntivirus(c *config.Config, l log.Logger, tp trace.TracerProvider) (Antivirus, error) {
+
 	var scanner Scanner
 	var err error
-	switch cfg.Scanner.Type {
+	switch c.Scanner.Type {
 	default:
-		return Antivirus{}, fmt.Errorf("unknown av scanner: '%s'", cfg.Scanner.Type)
-	case config.ScannerTypeClamAV:
-		scanner, err = scanners.NewClamAV(cfg.Scanner.ClamAV.Socket, cfg.Scanner.ClamAV.Timeout)
-	case config.ScannerTypeICap:
-		scanner, err = scanners.NewICAP(cfg.Scanner.ICAP.URL, cfg.Scanner.ICAP.Service, cfg.Scanner.ICAP.Timeout)
+		return Antivirus{}, fmt.Errorf("unknown av scanner: '%s'", c.Scanner.Type)
+	case "clamav":
+		scanner = scanners.NewClamAV(c.Scanner.ClamAV.Socket)
+	case "icap":
+		scanner, err = scanners.NewICAP(c.Scanner.ICAP.URL, c.Scanner.ICAP.Service, c.Scanner.ICAP.Timeout)
 	}
 	if err != nil {
 		return Antivirus{}, err
 	}
 
-	av := Antivirus{config: cfg, log: logger, tracerProvider: tracerProvider, scanner: scanner, client: rhttp.GetHTTPClient(rhttp.Insecure(true))}
+	av := Antivirus{c: c, l: l, tp: tp, s: scanner, client: rhttp.GetHTTPClient(rhttp.Insecure(true))}
 
-	switch mode := cfg.MaxScanSizeMode; mode {
-	case config.MaxScanSizeModeSkip, config.MaxScanSizeModePartial:
-		break
-	default:
-		return av, fmt.Errorf("unknown max scan size mode '%s'", cfg.MaxScanSizeMode)
-	}
-
-	switch outcome := events.PostprocessingOutcome(cfg.InfectedFileHandling); outcome {
+	switch o := events.PostprocessingOutcome(c.InfectedFileHandling); o {
 	case events.PPOutcomeContinue, events.PPOutcomeAbort, events.PPOutcomeDelete:
-		av.outcome = outcome
+		av.o = o
 	default:
-		return av, fmt.Errorf("unknown infected file handling '%s'", outcome)
+		return av, fmt.Errorf("unknown infected file handling '%s'", o)
 	}
 
-	if cfg.MaxScanSize != "" {
-		b, err := bytesize.Parse(cfg.MaxScanSize)
+	if c.MaxScanSize != "" {
+		b, err := bytesize.Parse(c.MaxScanSize)
 		if err != nil {
 			return av, err
 		}
 
-		av.maxScanSize = b.Bytes()
+		av.m = b.Bytes()
 	}
 
 	return av, nil
@@ -83,23 +76,23 @@ func NewAntivirus(cfg *config.Config, logger log.Logger, tracerProvider trace.Tr
 
 // Antivirus defines implements the business logic for Service.
 type Antivirus struct {
-	config         *config.Config
-	log            log.Logger
-	scanner        Scanner
-	outcome        events.PostprocessingOutcome
-	maxScanSize    uint64
-	tracerProvider trace.TracerProvider
+	c  *config.Config
+	l  log.Logger
+	s  Scanner
+	o  events.PostprocessingOutcome
+	m  uint64
+	tp trace.TracerProvider
 
 	client *http.Client
 }
 
 // Run runs the service
 func (av Antivirus) Run() error {
-	eventsCfg := av.config.Events
+	evtsCfg := av.c.Events
 
 	var rootCAPool *x509.CertPool
-	if av.config.Events.TLSRootCACertificate != "" {
-		rootCrtFile, err := os.Open(eventsCfg.TLSRootCACertificate)
+	if av.c.Events.TLSRootCACertificate != "" {
+		rootCrtFile, err := os.Open(evtsCfg.TLSRootCACertificate)
 		if err != nil {
 			return err
 		}
@@ -111,10 +104,10 @@ func (av Antivirus) Run() error {
 
 		rootCAPool = x509.NewCertPool()
 		rootCAPool.AppendCertsFromPEM(certBytes.Bytes())
-		av.config.Events.TLSInsecure = false
+		av.c.Events.TLSInsecure = false
 	}
 
-	natsStream, err := stream.NatsFromConfig(av.config.Service.Name, false, stream.NatsConfig(av.config.Events))
+	natsStream, err := stream.NatsFromConfig(av.c.Service.Name, false, stream.NatsConfig(av.c.Events))
 	if err != nil {
 		return err
 	}
@@ -125,7 +118,7 @@ func (av Antivirus) Run() error {
 	}
 
 	wg := sync.WaitGroup{}
-	for i := 0; i < av.config.Workers; i++ {
+	for i := 0; i < av.c.Workers; i++ {
 		wg.Add(1)
 		go func() {
 			defer wg.Done()
@@ -134,11 +127,11 @@ func (av Antivirus) Run() error {
 				if err != nil {
 					switch {
 					case errors.Is(err, ErrFatal):
-						av.log.Fatal().Err(err).Msg("fatal error - exiting")
+						av.l.Fatal().Err(err).Msg("fatal error - exiting")
 					case errors.Is(err, ErrEvent):
-						av.log.Error().Err(err).Msg("continuing")
+						av.l.Error().Err(err).Msg("continuing")
 					default:
-						av.log.Fatal().Err(err).Msg("unknown error - exiting")
+						av.l.Fatal().Err(err).Msg("unknown error - exiting")
 					}
 				}
 			}
@@ -150,20 +143,20 @@ func (av Antivirus) Run() error {
 }
 
 func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
-	ctx, span := av.tracerProvider.Tracer("antivirus").Start(e.GetTraceContext(context.Background()), "processEvent")
+	ctx := e.GetTraceContext(context.Background())
+	ctx, span := av.tp.Tracer("antivirus").Start(ctx, "processEvent")
 	defer span.End()
-	av.log.Info().Str("traceID", span.SpanContext().TraceID().String()).Msg("TraceID")
-
+	av.l.Info().Str("traceID", span.SpanContext().TraceID().String()).Msg("TraceID")
 	ev := e.Event.(events.StartPostprocessingStep)
 	if ev.StepToStart != events.PPStepAntivirus {
 		return nil
 	}
 
-	if av.config.DebugScanOutcome != "" {
-		av.log.Warn().Str("antivir, clamav", ">>>>>>> ANTIVIRUS_DEBUG_SCAN_OUTCOME IS SET NO ACTUAL VIRUS SCAN IS PERFORMED!").Send()
+	if av.c.DebugScanOutcome != "" {
+		av.l.Warn().Str("antivir, clamav", ">>>>>>> ANTIVIRUS_DEBUG_SCAN_OUTCOME IS SET NO ACTUAL VIRUS SCAN IS PERFORMED!").Send()
 		if err := events.Publish(ctx, s, events.PostprocessingStepFinished{
 			FinishedStep:  events.PPStepAntivirus,
-			Outcome:       events.PostprocessingOutcome(av.config.DebugScanOutcome),
+			Outcome:       events.PostprocessingOutcome(av.c.DebugScanOutcome),
 			UploadID:      ev.UploadID,
 			ExecutingUser: ev.ExecutingUser,
 			Filename:      ev.Filename,
@@ -174,14 +167,13 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
 				ResourceID:  ev.ResourceID,
 			},
 		}); err != nil {
-			av.log.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
+			av.l.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
 			return fmt.Errorf("%w: cannot publish events", ErrFatal)
 		}
 		return fmt.Errorf("%w: no actual virus scan performed", ErrEvent)
 	}
 
-	av.log.Debug().Str("uploadid", ev.UploadID).Str("filename", ev.Filename).Msg("Starting virus scan.")
-
+	av.l.Debug().Str("uploadid", ev.UploadID).Str("filename", ev.Filename).Msg("Starting virus scan.")
 	var errmsg string
 	start := time.Now()
 	res, err := av.process(ev)
@@ -193,17 +185,17 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
 	var outcome events.PostprocessingOutcome
 	switch {
 	case res.Infected:
-		outcome = av.outcome
+		outcome = av.o
 	case !res.Infected && err == nil:
 		outcome = events.PPOutcomeContinue
 	case err != nil:
 		outcome = events.PPOutcomeRetry
 	default:
-		// Not sure what this is about. Abort.
+		// Not sure what this is about. abort.
 		outcome = events.PPOutcomeAbort
 	}
 
-	av.log.Info().Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Str("virus", res.Description).Str("outcome", string(outcome)).Str("filename", ev.Filename).Str("user", ev.ExecutingUser.GetId().GetOpaqueId()).Bool("infected", res.Infected).Dur("duration", duration).Msg("File scanned")
+	av.l.Info().Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Str("virus", res.Description).Str("outcome", string(outcome)).Str("filename", ev.Filename).Str("user", ev.ExecutingUser.GetId().GetOpaqueId()).Bool("infected", res.Infected).Dur("duration", duration).Msg("File scanned")
 	if err := events.Publish(ctx, s, events.PostprocessingStepFinished{
 		FinishedStep:  events.PPStepAntivirus,
 		Outcome:       outcome,
@@ -218,7 +210,7 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
 			ErrorMsg:    errmsg,
 		},
 	}); err != nil {
-		av.log.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
+		av.l.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
 		return fmt.Errorf("%w: %s", ErrFatal, err)
 	}
 	return nil
@@ -226,24 +218,11 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
 
 // process the scan
 func (av Antivirus) process(ev events.StartPostprocessingStep) (scanners.Result, error) {
-	if ev.Filesize == 0 {
-		av.log.Info().Str("uploadid", ev.UploadID).Msg("Skipping file to be virus scanned, file size is 0.")
-		return scanners.Result{ScanTime: time.Now()}, nil
-	}
-
-	headers := make(map[string]string)
-	switch {
-	case av.maxScanSize == 0:
-		// there is no size limit
-		break
-	case av.config.MaxScanSizeMode == config.MaxScanSizeModeSkip && ev.Filesize > av.maxScanSize:
-		// skip the file if it is bigger than the max scan size
-		av.log.Info().Str("uploadid", ev.UploadID).Uint64("filesize", ev.Filesize).
-			Msg("Skipping file to be virus scanned, file size is bigger than max scan size.")
-		return scanners.Result{ScanTime: time.Now()}, nil
-	case av.config.MaxScanSizeMode == config.MaxScanSizeModePartial && ev.Filesize > av.maxScanSize:
-		// set the range header to only download the first maxScanSize bytes
-		headers["Range"] = fmt.Sprintf("bytes=0-%d", av.maxScanSize-1)
+	if ev.Filesize == 0 || (0 < av.m && av.m < ev.Filesize) {
+		av.l.Info().Str("uploadid", ev.UploadID).Uint64("limit", av.m).Uint64("filesize", ev.Filesize).Msg("Skipping file to be virus scanned because its file size is higher than the defined limit.")
+		return scanners.Result{
+			ScanTime: time.Now(),
+		}, nil
 	}
 
 	var err error
@@ -251,61 +230,56 @@ func (av Antivirus) process(ev events.StartPostprocessingStep) (scanners.Result,
 
 	switch ev.UploadID {
 	default:
-		rrc, err = av.downloadViaToken(ev.URL, headers)
+		rrc, err = av.downloadViaToken(ev.URL)
 	case "":
-		rrc, err = av.downloadViaReva(ev.URL, ev.Token, ev.RevaToken, headers)
+		rrc, err = av.downloadViaReva(ev.URL, ev.Token, ev.RevaToken)
 	}
 	if err != nil {
-		av.log.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error downloading file")
+		av.l.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error downloading file")
 		return scanners.Result{}, err
 	}
-	defer func() {
-		_ = rrc.Close()
-	}()
+	defer rrc.Close()
+	av.l.Debug().Str("uploadid", ev.UploadID).Msg("Downloaded file successfully, starting virusscan")
 
-	av.log.Debug().Str("uploadid", ev.UploadID).Msg("Downloaded file successfully, starting virusscan")
-
-	res, err := av.scanner.Scan(scanners.Input{Body: rrc, Size: int64(ev.Filesize), Url: ev.URL, Name: ev.Filename})
+	res, err := av.s.Scan(scanners.Input{Body: rrc, Size: int64(ev.Filesize), Url: ev.URL, Name: ev.Filename})
 	if err != nil {
-		av.log.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error scanning file")
+		av.l.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error scanning file")
 	}
 
 	return res, err
 }
 
 // download will download the file
-func (av Antivirus) downloadViaToken(url string, headers map[string]string) (io.ReadCloser, error) {
+func (av Antivirus) downloadViaToken(url string) (io.ReadCloser, error) {
 	req, err := http.NewRequest(http.MethodGet, url, nil)
 	if err != nil {
 		return nil, err
 	}
 
-	return av.doDownload(req, headers)
+	return av.doDownload(req)
 }
 
 // download will download the file
-func (av Antivirus) downloadViaReva(url string, dltoken string, revatoken string, headers map[string]string) (io.ReadCloser, error) {
-	req, err := rhttp.NewRequest(ctxpkg.ContextSetToken(context.Background(), revatoken), http.MethodGet, url, nil)
+func (av Antivirus) downloadViaReva(url string, dltoken string, revatoken string) (io.ReadCloser, error) {
+	ctx := ctxpkg.ContextSetToken(context.Background(), revatoken)
+
+	req, err := rhttp.NewRequest(ctx, http.MethodGet, url, nil)
 	if err != nil {
 		return nil, err
 	}
 	req.Header.Set("X-Reva-Transfer", dltoken)
 
-	return av.doDownload(req, headers)
+	return av.doDownload(req)
 }
 
-func (av Antivirus) doDownload(req *http.Request, headers map[string]string) (io.ReadCloser, error) {
-	for k, v := range headers {
-		req.Header.Add(k, v)
-	}
-
+func (av Antivirus) doDownload(req *http.Request) (io.ReadCloser, error) {
 	res, err := av.client.Do(req)
 	if err != nil {
 		return nil, err
 	}
 
-	if !slices.Contains([]int{http.StatusOK, http.StatusPartialContent}, res.StatusCode) {
-		_ = res.Body.Close()
+	if res.StatusCode != http.StatusOK {
+		res.Body.Close()
 		return nil, fmt.Errorf("unexpected status code from Download %v", res.StatusCode)
 	}
 

services/clientlog/pkg/service/service.go

@@ -11,6 +11,7 @@ import (
 	gateway "github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1"
 	group "github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1"
 	user "github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1"
+	rpc "github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1"
 	provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1"
 	"go.opentelemetry.io/otel/trace"
 
@@ -218,16 +219,33 @@ func processShareEvent(ctx context.Context, ref *provider.Reference, gwc gateway
 
 // custom logic for item trashed event
 func processItemTrashedEvent(ctx context.Context, ref *provider.Reference, gwc gateway.GatewayAPIClient, initiatorid string, itemID *provider.ResourceId) ([]string, FileEvent, error) {
-	data := FileEvent{
-		ItemID: storagespace.FormatResourceID(itemID),
-		// TODO: check with web if parentID is needed
-		// ParentItemID: storagespace.FormatResourceID(*item.GetRef().GetResourceId()),
-		SpaceID:     storagespace.FormatStorageID(itemID.GetStorageId(), itemID.GetSpaceId()),
-		InitiatorID: initiatorid,
+	resp, err := gwc.ListRecycle(ctx, &provider.ListRecycleRequest{
+		Ref: ref,
+		Key: itemID.GetOpaqueId(),
+	})
+	if err != nil {
+		return nil, FileEvent{}, err
+	}
+	if resp.GetStatus().GetCode() != rpc.Code_CODE_OK {
+		return nil, FileEvent{}, fmt.Errorf("error listing recycle: %s", resp.GetStatus().GetMessage())
 	}
 
-	users, err := utils.GetSpaceMembers(ctx, itemID.GetSpaceId(), gwc, utils.ViewerRole)
-	return users, data, err
+	for _, item := range resp.GetRecycleItems() {
+		if item.GetKey() == itemID.GetOpaqueId() {
+
+			data := FileEvent{
+				ItemID: storagespace.FormatResourceID(itemID),
+				// TODO: check with web if parentID is needed
+				// ParentItemID: storagespace.FormatResourceID(*item.GetRef().GetResourceId()),
+				SpaceID:     storagespace.FormatStorageID(itemID.GetStorageId(), itemID.GetSpaceId()),
+				InitiatorID: initiatorid,
+			}
+
+			users, err := utils.GetSpaceMembers(ctx, itemID.GetSpaceId(), gwc, utils.ViewerRole)
+			return users, data, err
+		}
+	}
+	return nil, FileEvent{}, errors.New("item not found in recycle bin")
 }
 
 // adds share related data to the FileEvent

services/frontend/pkg/config/config.go

@@ -34,7 +34,6 @@ type Config struct {
 	EnableFederatedSharingIncoming bool   `yaml:"enable_federated_sharing_incoming" env:"OC_ENABLE_OCM;FRONTEND_ENABLE_FEDERATED_SHARING_INCOMING" desc:"Changing this value is NOT supported. Enables support for incoming federated sharing for clients. The backend behaviour is not changed." introductionVersion:"1.0.0"`
 	EnableFederatedSharingOutgoing bool   `yaml:"enable_federated_sharing_outgoing" env:"OC_ENABLE_OCM;FRONTEND_ENABLE_FEDERATED_SHARING_OUTGOING" desc:"Changing this value is NOT supported. Enables support for outgoing federated sharing for clients. The backend behaviour is not changed." introductionVersion:"1.0.0"`
 	SearchMinLength                int    `yaml:"search_min_length" env:"FRONTEND_SEARCH_MIN_LENGTH" desc:"Minimum number of characters to enter before a client should start a search for Share receivers. This setting can be used to customize the user experience if e.g too many results are displayed." introductionVersion:"1.0.0"`
-	Edition                        string `yaml:"edition" env:"OC_EDITION;FRONTEND_EDITION" desc:"Edition of OpenCloud. Used for branding purposes." introductionVersion:"1.0.0"`
 	DisableSSE                     bool   `yaml:"disable_sse" env:"OC_DISABLE_SSE;FRONTEND_DISABLE_SSE" desc:"When set to true, clients are informed that the Server-Sent Events endpoint is not accessible." introductionVersion:"1.0.0"`
 	DefaultLinkPermissions         int    `yaml:"default_link_permissions" env:"FRONTEND_DEFAULT_LINK_PERMISSIONS" desc:"Defines the default permissions a link is being created with. Possible values are 0 (= internal link, for instance members only) and 1 (= public link with viewer permissions). Defaults to 1." introductionVersion:"1.0.0"`
 

services/frontend/pkg/config/defaults/defaultconfig.go

@@ -87,7 +87,6 @@ func DefaultConfig() *config.Config {
 		DefaultUploadProtocol:    "tus",
 		DefaultLinkPermissions:   1,
 		SearchMinLength:          3,
-		Edition:                  "",
 		Checksums: config.Checksums{
 			SupportedTypes:      []string{"sha1", "md5", "adler32"},
 			PreferredUploadType: "sha1",

services/frontend/pkg/revaconfig/config.go

@@ -208,7 +208,6 @@ func FrontendConfigFromStruct(cfg *config.Config, logger log.Logger) (map[string
 									"needsDbUpgrade": false,
 									"version":        version.Legacy,
 									"versionstring":  version.LegacyString,
-									"edition":        cfg.Edition,
 									"productname":    "OpenCloud",
 									"product":        "OpenCloud",
 									"productversion": version.GetString(),

services/graph/pkg/service/v0/api_driveitem_permissions.go

@@ -83,7 +83,6 @@ func NewDriveItemPermissionsService(logger log.Logger, gatewaySelector pool.Sele
 			gatewaySelector: gatewaySelector,
 			identityCache:   identityCache,
 			config:          config,
-			availableRoles:  unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(config.UnifiedRoles.AvailableRoles...)),
 		},
 	}, nil
 }

services/graph/pkg/service/v0/api_driveitem_permissions_test.go

@@ -441,6 +441,7 @@ var _ = Describe("DriveItemPermissionsService", func() {
 		})
 		It("returns role denied", func() {
 			statResponse.Info.PermissionSet = roleconversions.NewManagerRole().CS3ResourcePermissions()
+			cfg.UnifiedRoles.AvailableRoles = []string{unifiedrole.UnifiedRoleViewerID, unifiedrole.UnifiedRoleDeniedID, unifiedrole.UnifiedRoleManagerID}
 			listSharesResponse.Shares = []*collaboration.Share{
 				{
 					Id: &collaboration.ShareId{OpaqueId: "1"},
@@ -464,15 +465,11 @@ var _ = Describe("DriveItemPermissionsService", func() {
 			}
 			listPublicSharesResponse.Share = []*link.PublicShare{}
 
-			cfg = defaults.FullDefaultConfig()
-			cfg.UnifiedRoles.AvailableRoles = []string{unifiedrole.UnifiedRoleViewerID, unifiedrole.UnifiedRoleDeniedID, unifiedrole.UnifiedRoleManagerID}
-			service, err := svc.NewDriveItemPermissionsService(log.NewLogger(), gatewaySelector, cache, cfg)
-
 			gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil)
 			gatewayClient.On("ListShares", mock.Anything, mock.Anything).Return(listSharesResponse, nil)
 			gatewayClient.On("GetUser", mock.Anything, mock.Anything).Return(getUserResponse, nil)
 			gatewayClient.On("ListPublicShares", mock.Anything, mock.Anything).Return(listPublicSharesResponse, nil)
-			permissions, err := service.ListPermissions(context.Background(), itemID, false, false)
+			permissions, err := driveItemPermissionsService.ListPermissions(context.Background(), itemID, false, false)
 			Expect(err).ToNot(HaveOccurred())
 			Expect(len(permissions.LibreGraphPermissionsActionsAllowedValues)).ToNot(BeZero())
 			Expect(len(permissions.LibreGraphPermissionsRolesAllowedValues)).ToNot(BeZero())

services/graph/pkg/service/v0/base.go

@@ -46,7 +46,6 @@ type BaseGraphService struct {
 	gatewaySelector pool.Selectable[gateway.GatewayAPIClient]
 	identityCache   identity.IdentityCache
 	config          *config.Config
-	availableRoles  []*libregraph.UnifiedRoleDefinition
 }
 
 func (g BaseGraphService) getSpaceRootPermissions(ctx context.Context, spaceID *storageprovider.StorageSpaceId) ([]libregraph.Permission, error) {
@@ -87,7 +86,8 @@ func (g BaseGraphService) CS3ReceivedSharesToDriveItems(ctx context.Context, rec
 		return nil, err
 	}
 
-	return cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, g.availableRoles)
+	availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
+	return cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, availableRoles)
 }
 
 func (g BaseGraphService) CS3ReceivedOCMSharesToDriveItems(ctx context.Context, receivedShares []*ocm.ReceivedShare) ([]libregraph.DriveItem, error) {
@@ -96,7 +96,8 @@ func (g BaseGraphService) CS3ReceivedOCMSharesToDriveItems(ctx context.Context,
 		return nil, err
 	}
 
-	return cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, g.availableRoles)
+	availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
+	return cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, availableRoles)
 }
 
 func (g BaseGraphService) cs3SpacePermissionsToLibreGraph(ctx context.Context, space *storageprovider.StorageSpace, apiVersion APIVersion) []libregraph.Permission {
@@ -195,8 +196,9 @@ func (g BaseGraphService) cs3SpacePermissionsToLibreGraph(ctx context.Context, s
 			p.SetExpirationDateTime(time.Unix(int64(exp.GetSeconds()), int64(exp.GetNanos())))
 		}
 
+		availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
 		if role := unifiedrole.CS3ResourcePermissionsToRole(
-			g.availableRoles,
+			availableRoles,
 			perm,
 			unifiedrole.UnifiedRoleConditionDrive,
 			false,
@@ -599,7 +601,7 @@ func (g BaseGraphService) cs3UserShareToPermission(ctx context.Context, share *c
 		perm.SetCreatedDateTime(cs3TimestampToTime(share.GetCtime()))
 	}
 	role := unifiedrole.CS3ResourcePermissionsToRole(
-		g.availableRoles,
+		unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...)),
 		share.GetPermissions().GetPermissions(),
 		roleCondition,
 		false,
@@ -687,8 +689,9 @@ func (g BaseGraphService) cs3OCMShareToPermission(ctx context.Context, share *oc
 		}
 	}
 
+	availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
 	role := unifiedrole.CS3ResourcePermissionsToRole(
-		g.availableRoles,
+		availableRoles,
 		permissions,
 		roleCondition,
 		true,

services/graph/pkg/service/v0/rolemanagement.go

@@ -14,7 +14,7 @@ import (
 // GetRoleDefinitions a list of permission roles than can be used when sharing with users or groups
 func (g Graph) GetRoleDefinitions(w http.ResponseWriter, r *http.Request) {
 	render.Status(r, http.StatusOK)
-	render.JSON(w, r, g.availableRoles)
+	render.JSON(w, r, unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...)))
 }
 
 // GetRoleDefinition a permission role than can be used when sharing with users or groups

services/graph/pkg/service/v0/service.go

@@ -31,7 +31,6 @@ import (
 	"github.com/opencloud-eu/opencloud/services/graph/pkg/identity"
 	"github.com/opencloud-eu/opencloud/services/graph/pkg/identity/ldap"
 	graphm "github.com/opencloud-eu/opencloud/services/graph/pkg/middleware"
-	"github.com/opencloud-eu/opencloud/services/graph/pkg/unifiedrole"
 )
 
 const (
@@ -149,7 +148,6 @@ func NewService(opts ...Option) (Graph, error) { //nolint:maintidx
 			identityCache:   identityCache,
 			gatewaySelector: options.GatewaySelector,
 			config:          options.Config,
-			availableRoles:  unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(options.Config.UnifiedRoles.AvailableRoles...)),
 		},
 		mux:                      m,
 		specialDriveItemsCache:   spacePropertiesCache,

services/graph/pkg/service/v0/sharedwithme.go

@@ -10,6 +10,7 @@ import (
 	libregraph "github.com/owncloud/libre-graph-api-go"
 
 	"github.com/opencloud-eu/opencloud/services/graph/pkg/errorcode"
+	"github.com/opencloud-eu/opencloud/services/graph/pkg/unifiedrole"
 )
 
 // ListSharedWithMe lists the files shared with the current user.
@@ -39,7 +40,8 @@ func (g Graph) listSharedWithMe(ctx context.Context) ([]libregraph.DriveItem, er
 		g.logger.Error().Err(err).Msg("listing shares failed")
 		return nil, err
 	}
-	driveItems, err := cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedSharesResponse.GetShares(), g.availableRoles)
+	availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
+	driveItems, err := cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedSharesResponse.GetShares(), availableRoles)
 	if err != nil {
 		g.logger.Error().Err(err).Msg("could not convert received shares to drive items")
 		return nil, err
@@ -51,7 +53,7 @@ func (g Graph) listSharedWithMe(ctx context.Context) ([]libregraph.DriveItem, er
 			g.logger.Error().Err(err).Msg("listing shares failed")
 			return nil, err
 		}
-		ocmDriveItems, err := cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedOCMSharesResponse.GetShares(), g.availableRoles)
+		ocmDriveItems, err := cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedOCMSharesResponse.GetShares(), availableRoles)
 		if err != nil {
 			g.logger.Error().Err(err).Msg("could not convert received ocm shares to drive items")
 			return nil, err

services/idp/Makefile

@@ -17,16 +17,15 @@ node-generate-prod: assets
 .PHONY: assets
 assets: pnpm-build \
 		assets/identifier/static \
-		assets/identifier/static/favicon.svg \
+		assets/identifier/static/favicon.ico \
 		assets/identifier/static/icon-lilac.svg
 
 assets/identifier/static:
 	mkdir -p assets/identifier/static
 
-.PHONY: assets/identifier/static/favicon.svg # force overwrite
-assets/identifier/static/favicon.svg:
-	cp src/images/favicon.svg assets/identifier/static/favicon.svg
-	rm assets/identifier/static/favicon.ico
+.PHONY: assets/identifier/static/favicon.ico # force overwrite
+assets/identifier/static/favicon.ico:
+	cp src/images/favicon.ico assets/identifier/static/favicon.ico
 
 .PHONY: assets/identifier/static/icon-lilac.svg
 assets/identifier/static/icon-lilac.svg:

services/idp/package.json

@@ -102,7 +102,7 @@
     "redux-logger": "^3.0.6",
     "redux-thunk": "^2.4.2",
     "render-if": "^0.1.1",
-    "web-vitals": "^4.2.4"
+    "web-vitals": "^3.5.2"
   },
   "devDependencies": {
     "@babel/core": "7.26.10",
@@ -125,7 +125,7 @@
     "eslint-plugin-i18next": "^6.1.1",
     "eslint-plugin-import": "^2.30.0",
     "eslint-plugin-jest": "^24.7.0",
-    "eslint-plugin-jsx-a11y": "^6.10.2",
+    "eslint-plugin-jsx-a11y": "^6.9.0",
     "eslint-plugin-react": "^7.37.2",
     "eslint-plugin-react-hooks": "^4.6.2",
     "eslint-plugin-testing-library": "^3.10.2",
@@ -148,7 +148,7 @@
     "resolve-url-loader": "^5.0.0",
     "sass-loader": "^16.0.4",
     "source-map-explorer": "^2.5.3",
-    "typescript": "^5.8.3",
+    "typescript": "^5.7.3",
     "url-loader": "4.1.1",
     "webpack": "5.96.1",
     "webpack-manifest-plugin": "5.0.0",

services/idp/public/index.html

@@ -4,7 +4,7 @@
     <meta charset="utf-8">
     <meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no">
     <meta name="theme-color" content="#1b223d">
-    <link rel="icon" href="%PUBLIC_URL%/static/favicon.svg" type="image/svg+xml">
+    <link rel="shortcut icon" href="%PUBLIC_URL%/static/favicon.ico" type="image/x-icon">
     <meta property="csp-nonce" content="__CSP_NONCE__">
     <title>Sign in - OpenCloud</title>
   </head>

services/idp/src/images/favicon.svg

@@ -1,3 +0,0 @@
-<svg xmlns="http://www.w3.org/2000/svg" version="1.1" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:svgjs="http://svgjs.dev/svgjs" width="512" height="512"><svg id="SvgjsSvg1001" xmlns="http://www.w3.org/2000/svg" width="512" height="512" viewBox="0 0 512 512"><rect x=".02" y="0" width="512" height="512" fill="#20434f"></rect><polygon points="255.98 342.75 271.89 333.57 271.89 267.12 329.08 234.1 329.08 215.78 313.18 206.6 255.6 239.84 198.83 207.06 182.93 216.24 182.93 234.56 240.12 267.58 240.12 333.59 255.98 342.75" fill="#e2baff"></polygon><polygon points="401.95 150.82 256 66.56 256 66.56 256 66.56 110.05 150.82 110.05 187.5 256 103.24 401.95 187.5 401.95 150.82" fill="#e2baff"></polygon><polygon points="401.95 324.5 256 408.76 110.06 324.5 110.06 361.17 256 445.43 256 445.43 256 445.43 401.95 361.17 401.95 324.5" fill="#e2baff"></polygon></svg><style>@media (prefers-color-scheme: light) { :root { filter: none; } }
-@media (prefers-color-scheme: dark) { :root { filter: none; } }
-</style></svg>

services/ocdav/pkg/command/server.go

@@ -77,7 +77,6 @@ func Server(cfg *config.Config) *cli.Command {
 					ocdav.Product(cfg.Status.Product),
 					ocdav.Version(cfg.Status.Version),
 					ocdav.VersionString(cfg.Status.VersionString),
-					ocdav.Edition(cfg.Status.Edition),
 					ocdav.MachineAuthAPIKey(cfg.MachineAuthAPIKey),
 					ocdav.Broker(broker.NoOp{}),
 					// ocdav.FavoriteManager() // FIXME needs a proper persistence implementation https://github.com/owncloud/ocis/issues/1228

services/ocdav/pkg/config/config.go

@@ -81,5 +81,4 @@ type Status struct {
 	Product        string
 	ProductName    string
 	ProductVersion string
-	Edition        string `yaml:"edition" env:"OC_EDITION;OCDAV_EDITION" desc:"Edition of OpenCloud. Used for branding purposes." introductionVersion:"1.0.0"`
 }

services/ocdav/pkg/config/defaults/defaultconfig.go

@@ -92,7 +92,6 @@ func DefaultConfig() *config.Config {
 			ProductVersion: version.GetString(),
 			Product:        "OpenCloud",
 			ProductName:    "OpenCloud",
-			Edition:        "",
 		},
 	}
 }

services/search/pkg/content/mocks/extractor.go

@@ -1,4 +1,4 @@
-// Code generated by mockery v2.53.2. DO NOT EDIT.
+// Code generated by mockery v2.53.0. DO NOT EDIT.
 
 package mocks
 

services/search/pkg/content/mocks/retriever.go

@@ -1,4 +1,4 @@
-// Code generated by mockery v2.53.2. DO NOT EDIT.
+// Code generated by mockery v2.53.0. DO NOT EDIT.
 
 package mocks
 

services/search/pkg/engine/mocks/engine.go

@@ -1,4 +1,4 @@
-// Code generated by mockery v2.53.2. DO NOT EDIT.
+// Code generated by mockery v2.53.0. DO NOT EDIT.
 
 package mocks
 

services/search/pkg/search/mocks/searcher.go

@@ -1,4 +1,4 @@
-// Code generated by mockery v2.53.2. DO NOT EDIT.
+// Code generated by mockery v2.53.0. DO NOT EDIT.
 
 package mocks
 

services/settings/pkg/settings/mocks/manager.go

@@ -1,4 +1,4 @@
-// Code generated by mockery v2.53.2. DO NOT EDIT.
+// Code generated by mockery v2.53.0. DO NOT EDIT.
 
 package mocks
 

services/storage-users/pkg/command/uploads.go

@@ -108,7 +108,7 @@ func ListUploadSessions(cfg *config.Config) *cli.Command {
 			var fsStream events.Stream
 			if cfg.Driver == "posix" {
 				// We need to init the posix driver with 'scanfs' disabled
-				drivers["posix"] = revaconfig.Posix(cfg, false, false)
+				drivers["posix"] = revaconfig.Posix(cfg, false)
 				// Also posix refuses to start without an events stream
 				fsStream, err = event.NewStream(cfg)
 				if err != nil {

services/storage-users/pkg/config/defaults/defaultconfig.go

@@ -123,6 +123,7 @@ func DefaultConfig() *config.Config {
 				MaxConcurrency:             5,
 				LockCycleDurationFactor:    30,
 				DisableMultipart:           true,
+				AsyncUploads:               true,
 			},
 			Decomposed: config.DecomposedDriver{
 				Propagator:                 "sync",

services/storage-users/pkg/revaconfig/drivers.go

@@ -85,7 +85,7 @@ func Local(cfg *config.Config) map[string]interface{} {
 }
 
 // Posix is the config mapping for the Posix storage driver
-func Posix(cfg *config.Config, enableFSScan, enableFSWatch bool) map[string]interface{} {
+func Posix(cfg *config.Config, enableFSScan bool) map[string]interface{} {
 	return map[string]interface{}{
 		"root":                        cfg.Drivers.Posix.Root,
 		"personalspacepath_template":  cfg.Drivers.Posix.PersonalSpacePathTemplate,
@@ -137,7 +137,7 @@ func Posix(cfg *config.Config, enableFSScan, enableFSWatch bool) map[string]inte
 		"use_space_groups":           cfg.Drivers.Posix.UseSpaceGroups,
 		"enable_fs_revisions":        cfg.Drivers.Posix.EnableFSRevisions,
 		"scan_fs":                    enableFSScan,
-		"watch_fs":                   enableFSWatch,
+		"watch_fs":                   cfg.Drivers.Posix.WatchFS,
 		"watch_type":                 cfg.Drivers.Posix.WatchType,
 		"watch_path":                 cfg.Drivers.Posix.WatchPath,
 		"watch_folder_kafka_brokers": cfg.Drivers.Posix.WatchFolderKafkaBrokers,

services/storage-users/pkg/revaconfig/user.go

@@ -16,7 +16,7 @@ func StorageProviderDrivers(cfg *config.Config) map[string]interface{} {
 		"decomposed":   DecomposedNoEvents(cfg),
 		"s3":           S3(cfg),
 		"decomposeds3": DecomposedS3NoEvents(cfg),
-		"posix":        Posix(cfg, true, cfg.Drivers.Posix.WatchFS),
+		"posix":        Posix(cfg, true),
 
 		"ocis": Decomposed(cfg),           // deprecated: use decomposed
 		"s3ng": DecomposedS3NoEvents(cfg), // deprecated: use decomposeds3
@@ -36,7 +36,7 @@ func DataProviderDrivers(cfg *config.Config) map[string]interface{} {
 		"decomposed":   Decomposed(cfg),
 		"s3":           S3(cfg),
 		"decomposeds3": DecomposedS3(cfg),
-		"posix":        Posix(cfg, false, false),
+		"posix":        Posix(cfg, false),
 
 		"ocis": Decomposed(cfg),           // deprecated: use decomposed
 		"s3ng": DecomposedS3NoEvents(cfg), // deprecated: use decomposeds3

services/web/Makefile

@@ -1,6 +1,6 @@
 SHELL := bash
 NAME := web
-WEB_ASSETS_VERSION = v2.2.0
+WEB_ASSETS_VERSION = v2.1.1
 WEB_ASSETS_BRANCH = main
 
 ifneq (, $(shell command -v go 2> /dev/null)) # suppress `command not found warnings` for non go targets in CI

services/web/assets/themes/opencloud-dev/assets/favicon.svg

@@ -1,3 +0,0 @@
-<svg xmlns="http://www.w3.org/2000/svg" version="1.1" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:svgjs="http://svgjs.dev/svgjs" width="512" height="512"><svg id="SvgjsSvg1001" xmlns="http://www.w3.org/2000/svg" width="512" height="512" viewBox="0 0 512 512"><rect x=".02" y="0" width="512" height="512" fill="#20434f"></rect><polygon points="255.98 342.75 271.89 333.57 271.89 267.12 329.08 234.1 329.08 215.78 313.18 206.6 255.6 239.84 198.83 207.06 182.93 216.24 182.93 234.56 240.12 267.58 240.12 333.59 255.98 342.75" fill="#e2baff"></polygon><polygon points="401.95 150.82 256 66.56 256 66.56 256 66.56 110.05 150.82 110.05 187.5 256 103.24 401.95 187.5 401.95 150.82" fill="#e2baff"></polygon><polygon points="401.95 324.5 256 408.76 110.06 324.5 110.06 361.17 256 445.43 256 445.43 256 445.43 401.95 361.17 401.95 324.5" fill="#e2baff"></polygon></svg><style>@media (prefers-color-scheme: light) { :root { filter: none; } }
-@media (prefers-color-scheme: dark) { :root { filter: none; } }
-</style></svg>

services/web/assets/themes/opencloud-dev/theme.json

@@ -43,7 +43,7 @@
           }
         },
         "logo": "themes/opencloud-dev/assets/logo.svg",
-        "favicon": "themes/opencloud-dev/assets/favicon.svg"
+        "favicon": "themes/opencloud-dev/assets/favicon.jpg"
       },
       "themes": [
         {

services/web/assets/themes/opencloud/assets/favicon.svg

@@ -1,3 +0,0 @@
-<svg xmlns="http://www.w3.org/2000/svg" version="1.1" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:svgjs="http://svgjs.dev/svgjs" width="512" height="512"><svg id="SvgjsSvg1001" xmlns="http://www.w3.org/2000/svg" width="512" height="512" viewBox="0 0 512 512"><rect x=".02" y="0" width="512" height="512" fill="#20434f"></rect><polygon points="255.98 342.75 271.89 333.57 271.89 267.12 329.08 234.1 329.08 215.78 313.18 206.6 255.6 239.84 198.83 207.06 182.93 216.24 182.93 234.56 240.12 267.58 240.12 333.59 255.98 342.75" fill="#e2baff"></polygon><polygon points="401.95 150.82 256 66.56 256 66.56 256 66.56 110.05 150.82 110.05 187.5 256 103.24 401.95 187.5 401.95 150.82" fill="#e2baff"></polygon><polygon points="401.95 324.5 256 408.76 110.06 324.5 110.06 361.17 256 445.43 256 445.43 256 445.43 401.95 361.17 401.95 324.5" fill="#e2baff"></polygon></svg><style>@media (prefers-color-scheme: light) { :root { filter: none; } }
-@media (prefers-color-scheme: dark) { :root { filter: none; } }
-</style></svg>

services/web/assets/themes/opencloud/theme.json

@@ -50,7 +50,7 @@
     "web": {
       "defaults": {
         "logo": "themes/opencloud/assets/logo.svg",
-        "favicon": "themes/opencloud/assets/favicon.svg",
+        "favicon": "themes/opencloud/assets/favicon.ico",
         "designTokens": {
           "breakpoints": {
             "xsmall-max": "",
@@ -94,9 +94,9 @@
           "label": "Light Theme",
           "designTokens": {
             "roles": {
-              "primary": "#E2BAFF",
+              "primary": "#07677F",
               "surfaceTint": "#07677F",
-              "onPrimary": "#19353F",
+              "onPrimary": "#FFFFFF",
               "primaryContainer": "#B7EAFF",
               "onPrimaryContainer": "#001F28",
               "secondary": "#20434f",
@@ -147,6 +147,17 @@
               "onChrome": "#ffffff"
             },
             "colorPalette": {
+              "background-accentuate": "rgba(255, 255, 5, 0.1)",
+              "background-default": "#ffffff",
+              "background-highlight": "#f1f3f4",
+              "background-hover": "#f4e5ff",
+              "background-muted": "#f8f8f8",
+              "background-secondary": "#ffffff",
+              "background-chrome": "#20434F",
+              "background-sidebar": "#F1F3F4",
+              "border": "#ecebee",
+              "color-components-apptopbar-background": "transparent",
+              "color-components-apptopbar-border": "#ceddee",
               "icon-archive": "#fbbe54",
               "icon-audio": "#700460",
               "icon-document": "#3b44a6",
@@ -156,7 +167,46 @@
               "icon-pdf": "#ec0d47",
               "icon-presentation": "#ee6b3b",
               "icon-spreadsheet": "#15c286",
-              "icon-video": "#045459"
+              "icon-video": "#045459",
+              "input-bg": "#ffffff",
+              "input-border": "#396676",
+              "input-text-default": "#19353f",
+              "input-text-muted": "#20434f",
+              "swatch-brand-contrast": "#19353f",
+              "swatch-brand-default": "#E2BAFF",
+              "swatch-brand-hover": "#f4e5ff",
+              "swatch-brand-muted": "#CA8DF5",
+              "swatch-primary-contrast": "#ffffff",
+              "swatch-primary-default": "#20434f",
+              "swatch-primary-gradient": "#20434f",
+              "swatch-primary-gradient-hover": "#20434f",
+              "swatch-primary-hover": "#20434f",
+              "swatch-primary-muted": "#20434f",
+              "swatch-primary-muted-hover": "#20434f",
+              "swatch-passive-contrast": "#ffffff",
+              "swatch-passive-default": "#19353f",
+              "swatch-passive-hover": "#19353f",
+              "swatch-passive-hover-outline": "#ffffff",
+              "swatch-passive-muted": "#19353f",
+              "swatch-inverse-contrast": "#19353f",
+              "swatch-inverse-default": "#ffffff",
+              "swatch-inverse-hover": "#ffffff",
+              "swatch-inverse-muted": "#dadada",
+              "swatch-danger-contrast": "#ffffff",
+              "swatch-danger-default": "#ba1a1a",
+              "swatch-danger-hover": "#b12b2b",
+              "swatch-danger-muted": "rgb(204, 117, 117)",
+              "swatch-success-contrast": "#ffffff",
+              "swatch-success-default": "rgb(3, 84, 63)",
+              "swatch-success-hover": "#023b2c",
+              "swatch-success-muted": "rgb(83, 150, 10)",
+              "swatch-warning-contrast": "#ffffff",
+              "swatch-warning-default": "rgb(183, 76, 27)",
+              "swatch-warning-hover": "#a04318",
+              "swatch-warning-muted": "rgba(183, 76, 27, .5)",
+              "text-default": "#19353f",
+              "text-inverse": "#ffffff",
+              "text-muted": "#19353f"
             }
           }
         }

tests/README.md

@@ -466,7 +466,7 @@ ANTIVIRUS_SCANNER_TYPE="clamav" \
 ANTIVIRUS_CLAMAV_SOCKET="tcp://host.docker.internal:3310" \
 POSTPROCESSING_STEPS="virusscan" \
 OC_ASYNC_UPLOADS=true \
-OC_ADD_RUN_SERVICES="antivirus" \
+OC_ADD_RUN_SERVICES="antivirus"
 opencloud/bin/opencloud server
 ```
 
@@ -474,7 +474,7 @@ Note:
 The value for `ANTIVIRUS_CLAMAV_SOCKET` is an example which needs adaption according your OS.
 
 For antivirus running localy on Linux OS, use `ANTIVIRUS_CLAMAV_SOCKET= "/var/run/clamav/clamd.ctl"`.
-For antivirus running localy on Mac OS, use `ANTIVIRUS_CLAMAV_SOCKET= "/tmp/clamd.sock"`.
+For antivirus running localy on Mac OS, use `ANTIVIRUS_CLAMAV_SOCKET= "/tmp/clamd.socket"`.
 For antivirus running with docker, use `ANTIVIRUS_CLAMAV_SOCKET= "tcp://host.docker.internal:3310"`
 
 #### Run the Acceptance Test
@@ -576,7 +576,7 @@ make -C opencloud dev-docker
 ```
 
 ### Choose STORAGE_DRIVER
-By default, the system uses `posix` storage. However, you can override this by setting the `STORAGE_DRIVER` environment variable.
+By default, the system uses `decomposed` storage. However, you can override this by setting the `STORAGE_DRIVER` environment variable.
 
 
 ### Run a script that starts the openCloud server in the docker and runs the API tests locally (for debugging purposes) 

tests/acceptance/bootstrap/CapabilitiesContext.php

@@ -214,11 +214,6 @@ class CapabilitiesContext implements Context {
 		$this->featureContext->theHTTPStatusCodeShouldBe(200, '', $response);
 
 		$responseXmlObject = HttpRequestHelper::getResponseXml($response, __METHOD__)->data->capabilities;
-		$edition = $this->getParameterValueFromXml(
-			$responseXmlObject,
-			'core',
-			'status@@@edition'
-		);
 
 		$product = $this->getParameterValueFromXml(
 			$responseXmlObject,
@@ -243,7 +238,6 @@ class CapabilitiesContext implements Context {
 			);
 		}
 
-		$jsonExpectedDecoded['edition'] = $edition;
 		$jsonExpectedDecoded['product'] = $product;
 		$jsonExpectedDecoded['productname'] = $productName;
 

tests/acceptance/bootstrap/FeatureContext.php

@@ -2042,17 +2042,6 @@ class FeatureContext extends BehatVariablesContext {
 		);
 	}
 
-	/**
-	 * @return string
-	 */
-	public function getEditionFromStatus(): string {
-		$decodedResponse = $this->getJsonDecodedStatusPhp();
-		if (isset($decodedResponse['edition'])) {
-			return $decodedResponse['edition'];
-		}
-		return '';
-	}
-
 	/**
 	 * @return string|null
 	 */
@@ -2282,14 +2271,6 @@ class FeatureContext extends BehatVariablesContext {
 				],
 				"parameter" => []
 			],
-			[
-				"code" => "%edition%",
-				"function" => [
-					$this,
-					"getEditionFromStatus"
-				],
-				"parameter" => []
-			],
 			[
 				"code" => "%version%",
 				"function" => [

tests/acceptance/expected-failures-localAPI-on-decomposed-storage.md

@@ -193,6 +193,7 @@
 - [apiServiceAvailability/serviceAvailabilityCheck.feature:125](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiServiceAvailability/serviceAvailabilityCheck.feature#L125)
 
 #### [Skip tests for different languages](https://github.com/opencloud-eu/opencloud/issues/183)
+- [apiAntivirus/antivirus.feature:311](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiAntivirus/antivirus.feature#L311)
 - [apiActivities/activities.feature:2598](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiActivities/activities.feature#L2598)
 
 

tests/acceptance/features/apiAntivirus/antivirus.feature

@@ -308,7 +308,7 @@ Feature: antivirus
       | dav-path-version | language | subject          | message                                                                                                                   |
       | old              | es       | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Virus: Eicar-Signature                              |
       | new              | es       | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Virus: Eicar-Signature                              |
-      | spaces           | es       | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Virus: Eicar-Signature                                     |
+      | spaces           | es       | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Eicar-Signature                                     |
       | old              | de       | Virus gefunden   | In aFileWithVirus.txt wurde potenziell schädlicher Code gefunden. Das Hochladen wurde abgebrochen. Grund: Eicar-Signature |
       | new              | de       | Virus gefunden   | In aFileWithVirus.txt wurde potenziell schädlicher Code gefunden. Das Hochladen wurde abgebrochen. Grund: Eicar-Signature |
       | spaces           | de       | Virus gefunden   | In aFileWithVirus.txt wurde potenziell schädlicher Code gefunden. Das Hochladen wurde abgebrochen. Grund: Eicar-Signature |

tests/acceptance/features/coreApiCapabilities/capabilities.feature

@@ -193,17 +193,12 @@ Feature: capabilities
                   "status": {
                     "type": "object",
                     "required": [
-                      "edition",
                       "product",
                       "productname",
                       "version",
                       "versionstring"
                     ],
                     "properties": {
-                      "edition": {
-                        "type": "string",
-                        "enum": ["%edition%"]
-                      },
                       "product": {
                         "type": "string",
                         "enum": ["%productname%"]
@@ -230,7 +225,6 @@ Feature: capabilities
             "type": "object",
             "required": [
               "string",
-              "edition",
               "product"
             ],
             "properties": {
@@ -238,10 +232,6 @@ Feature: capabilities
                 "type": "string",
                 "enum": ["%versionstring%"]
               },
-              "edition": {
-                "type": "string",
-                "enum": ["%edition%"]
-              },
               "product": {
                 "type": "string",
                 "enum": ["%productname%"]

tests/acceptance/features/coreApiCapabilities/capabilitiesWithNormalUser.feature

@@ -47,7 +47,6 @@ Feature: default capabilities for normal user
                     "required": [
                       "version",
                       "versionstring",
-                      "edition",
                       "productname"
                     ],
                     "properties": {
@@ -57,9 +56,6 @@ Feature: default capabilities for normal user
                       "versionstring": {
                         "const": "%versionstring%"
                       },
-                      "edition": {
-                        "const": "%edition%"
-                      },
                       "productname": {
                         "const": "%productname%"
                       }

tests/acceptance/features/coreApiMain/status.feature

@@ -8,5 +8,5 @@ Feature: Status
     When the administrator requests status.php
     Then the status.php response should include
       """
-      {"installed":true,"maintenance":false,"needsDbUpgrade":false,"version":"$CURRENT_VERSION","versionstring":"$CURRENT_VERSION_STRING","edition":"$EDITION","productname":"$PRODUCTNAME","product":"$PRODUCT"}
+      {"installed":true,"maintenance":false,"needsDbUpgrade":false,"version":"$CURRENT_VERSION","versionstring":"$CURRENT_VERSION_STRING","productname":"$PRODUCTNAME","product":"$PRODUCT"}
       """

tests/acceptance/run_api_tests.sh

@@ -4,7 +4,7 @@
 export LOCAL_TEST=true
 export START_EMAIL=true
 export WITH_WRAPPER=true
-export STORAGE_DRIVER=${STORAGE_DRIVER:-posix}
+export STORAGE_DRIVER=${STORAGE_DRIVER:-decomposed}
 export TEST_ROOT_PATH="/drone/src/tests"
 
 # LOCAL TEST WITHOUT EXTRA ENVS

tests/config/woodpecker/check_go_bin_cache.sh

@@ -7,13 +7,15 @@
 
 ROOT_PATH="$1"
 if [ -z "$1" ]; then
-    ROOT_PATH="/woodpecker/src/github.com/opencloud-eu/opencloud"
+    ROOT_PATH="/drone/src"
 fi
 BINGO_DIR="$ROOT_PATH/.bingo"
 
 # generate hash of a .bingo folder
 BINGO_HASH=$(cat "$BINGO_DIR"/* | sha256sum | cut -d ' ' -f 1)
 
+URL="$CACHE_ENDPOINT/$CACHE_BUCKET/opencloud/go-bin/$BINGO_HASH/$2"
+
 mc alias set s3 "$MC_HOST" "$AWS_ACCESS_KEY_ID" "$AWS_SECRET_ACCESS_KEY"
 
 if mc ls --json s3/"$CACHE_BUCKET"/opencloud/go-bin/"$BINGO_HASH"/$2 | grep "\"status\":\"success\""; then

vendor/github.com/go-playground/validator/v10/.golangci.yaml

@@ -1,102 +0,0 @@
-version: "2"
-linters:
-  default: all
-  disable:
-    - asasalint
-    - asciicheck
-    - bidichk
-    - bodyclose
-    - canonicalheader
-    - containedctx
-    - contextcheck
-    - copyloopvar
-    - cyclop
-    - decorder
-    - depguard
-    - dogsled
-    - dupl
-    - dupword
-    - durationcheck
-    - err113
-    - errcheck
-    - errchkjson
-    - errname
-    - errorlint
-    - exhaustive
-    - exhaustruct
-    - exptostd
-    - fatcontext
-    - forbidigo
-    - forcetypeassert
-    - funlen
-    - ginkgolinter
-    - gocheckcompilerdirectives
-    - gochecknoglobals
-    - gochecknoinits
-    - gochecksumtype
-    - gocognit
-    - goconst
-    - gocritic
-    - gocyclo
-    - godot
-    - godox
-    - goheader
-    - gomoddirectives
-    - gomodguard
-    - goprintffuncname
-    - gosec
-    - gosmopolitan
-    - govet
-    - grouper
-    - iface
-    - importas
-    - inamedparam
-    - ineffassign
-    - interfacebloat
-    - intrange
-    - ireturn
-    - lll
-    - loggercheck
-    - maintidx
-    - makezero
-    - mirror
-    - misspell
-    - mnd
-    - musttag
-    - nakedret
-    - nestif
-    - nilerr
-    - nilnesserr
-    - nilnil
-    - nlreturn
-    - noctx
-    - nolintlint
-    - nonamedreturns
-    - nosprintfhostport
-    - paralleltest
-    - perfsprint
-    - prealloc
-    - predeclared
-    - promlinter
-    - protogetter
-    - reassign
-    - recvcheck
-    - revive
-    - rowserrcheck
-    - sloglint
-    - spancheck
-    - sqlclosecheck
-    - staticcheck
-    - tagalign
-    - tagliatelle
-    - testableexamples
-    - testifylint
-    - testpackage
-    - thelper
-    - tparallel
-    - unparam
-    - varnamelen
-    - whitespace
-    - wrapcheck
-    - wsl
-    - zerologlint

vendor/github.com/go-playground/validator/v10/Makefile

@@ -3,7 +3,7 @@ GOCMD=go
 linters-install:
 	@golangci-lint --version >/dev/null 2>&1 || { \
 		echo "installing linting tools..."; \
-		curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v2.0.2; \
+		curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v1.41.1; \
 	}
 
 lint: linters-install

vendor/github.com/go-playground/validator/v10/README.md

@@ -1,6 +1,7 @@
 Package validator
 =================
-<img align="right" src="logo.png">![Project status](https://img.shields.io/badge/version-10.25.0-green.svg)
+<img align="right" src="logo.png">[![Join the chat at https://gitter.im/go-playground/validator](https://badges.gitter.im/Join%20Chat.svg)](https://gitter.im/go-playground/validator?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge)
+![Project status](https://img.shields.io/badge/version-10.25.0-green.svg)
 [![Build Status](https://github.com/go-playground/validator/actions/workflows/workflow.yml/badge.svg)](https://github.com/go-playground/validator/actions)
 [![Coverage Status](https://coveralls.io/repos/go-playground/validator/badge.svg?branch=master&service=github)](https://coveralls.io/github/go-playground/validator?branch=master)
 [![Go Report Card](https://goreportcard.com/badge/github.com/go-playground/validator)](https://goreportcard.com/report/github.com/go-playground/validator)
@@ -172,7 +173,6 @@ validate := validator.New(validator.WithRequiredStructEnabled())
 | spicedb | SpiceDb ObjectID/Permission/Type |
 | datetime | Datetime |
 | e164 | e164 formatted phone number |
-| ein | U.S. Employeer Identification Number |
 | email | E-mail String
 | eth_addr | Ethereum Address |
 | hexadecimal | Hexadecimal String |

vendor/github.com/go-playground/validator/v10/baked_in.go

@@ -9,7 +9,6 @@ import (
 	"fmt"
 	"io/fs"
 	"net"
-	"net/mail"
 	"net/url"
 	"os"
 	"reflect"
@@ -243,7 +242,6 @@ var (
 		"mongodb_connection_string":     isMongoDBConnectionString,
 		"cron":                          isCron,
 		"spicedb":                       isSpiceDB,
-		"ein":                           isEIN,
 	}
 )
 
@@ -260,7 +258,7 @@ func parseOneOfParam2(s string) []string {
 		oneofValsCacheRWLock.Lock()
 		vals = splitParamsRegex().FindAllString(s, -1)
 		for i := 0; i < len(vals); i++ {
-			vals[i] = strings.ReplaceAll(vals[i], "'", "")
+			vals[i] = strings.Replace(vals[i], "'", "", -1)
 		}
 		oneofValsCache[s] = vals
 		oneofValsCacheRWLock.Unlock()
@@ -1378,6 +1376,7 @@ func isEqIgnoreCase(fl FieldLevel) bool {
 	param := fl.Param()
 
 	switch field.Kind() {
+
 	case reflect.String:
 		return strings.EqualFold(field.String(), param)
 	}
@@ -1607,6 +1606,7 @@ func isImage(fl FieldLevel) bool {
 	case reflect.String:
 		filePath := field.String()
 		fileInfo, err := os.Stat(filePath)
+
 		if err != nil {
 			return false
 		}
@@ -1619,9 +1619,7 @@ func isImage(fl FieldLevel) bool {
 		if err != nil {
 			return false
 		}
-		defer func() {
-			_ = file.Close()
-		}()
+		defer file.Close()
 
 		mime, err := mimetype.DetectReader(file)
 		if err != nil {
@@ -1637,6 +1635,7 @@ func isImage(fl FieldLevel) bool {
 
 // isFilePath is the validation function for validating if the current field's value is a valid file path.
 func isFilePath(fl FieldLevel) bool {
+
 	var exists bool
 	var err error
 
@@ -1696,10 +1695,6 @@ func isE164(fl FieldLevel) bool {
 
 // isEmail is the validation function for validating if the current field's value is a valid email address.
 func isEmail(fl FieldLevel) bool {
-	_, err := mail.ParseAddress(fl.Field().String())
-	if err != nil {
-		return false
-	}
 	return emailRegex().MatchString(fl.Field().String())
 }
 
@@ -2232,6 +2227,7 @@ func isGt(fl FieldLevel) bool {
 	case reflect.Struct:
 
 		if field.Type().ConvertibleTo(timeType) {
+
 			return field.Convert(timeType).Interface().(time.Time).After(time.Now().UTC())
 		}
 	}
@@ -2468,6 +2464,7 @@ func isLt(fl FieldLevel) bool {
 	case reflect.Struct:
 
 		if field.Type().ConvertibleTo(timeType) {
+
 			return field.Convert(timeType).Interface().(time.Time).Before(time.Now().UTC())
 		}
 	}
@@ -2647,6 +2644,7 @@ func isDir(fl FieldLevel) bool {
 
 // isDirPath is the validation function for validating if the current field's value is a valid directory.
 func isDirPath(fl FieldLevel) bool {
+
 	var exists bool
 	var err error
 
@@ -2959,12 +2957,6 @@ func isCveFormat(fl FieldLevel) bool {
 // a valid dns RFC 1035 label, defined in RFC 1035.
 func isDnsRFC1035LabelFormat(fl FieldLevel) bool {
 	val := fl.Field().String()
-
-	size := len(val)
-	if size > 63 {
-		return false
-	}
-
 	return dnsRegexRFC1035Label().MatchString(val)
 }
 
@@ -3068,14 +3060,3 @@ func isCron(fl FieldLevel) bool {
 	cronString := fl.Field().String()
 	return cronRegex().MatchString(cronString)
 }
-
-// isEIN is the validation function for validating if the current field's value is a valid U.S. Employer Identification Number (EIN)
-func isEIN(fl FieldLevel) bool {
-	field := fl.Field()
-
-	if field.Len() != 10 {
-		return false
-	}
-
-	return einRegex().MatchString(field.String())
-}

vendor/github.com/go-playground/validator/v10/cache.go

@@ -309,7 +309,7 @@ func (v *Validate) parseFieldTagsRecursive(tag string, fieldName string, alias s
 				}
 
 				if len(vals) > 1 {
-					current.param = strings.ReplaceAll(strings.ReplaceAll(vals[1], utf8HexComma, ","), utf8Pipe, "|")
+					current.param = strings.Replace(strings.Replace(vals[1], utf8HexComma, ",", -1), utf8Pipe, "|", -1)
 				}
 			}
 			current.isBlockEnd = true

vendor/github.com/go-playground/validator/v10/doc.go

@@ -959,7 +959,7 @@ Although an empty string is a valid base64 URL safe value, this will report
 an empty string as an error, if you wish to accept an empty string as valid
 you can use this with the omitempty tag.
 
-	Usage: base64rawurl
+	Usage: base64url
 
 # Bitcoin Address
 
@@ -1134,12 +1134,6 @@ This validates that a string value contains a valid longitude.
 
 	Usage: longitude
 
-# Employeer Identification Number EIN
-
-This validates that a string value contains a valid U.S. Employer Identification Number.
-
-	Usage: ein
-
 # Social Security Number SSN
 
 This validates that a string value contains a valid U.S. Social Security Number.

vendor/github.com/go-playground/validator/v10/regexes.go

@@ -69,7 +69,7 @@ const (
 	splitParamsRegexString           = `'[^']*'|\S+`
 	bicRegexString                   = `^[A-Za-z]{6}[A-Za-z0-9]{2}([A-Za-z0-9]{3})?$`
 	semverRegexString                = `^(0|[1-9]\d*)\.(0|[1-9]\d*)\.(0|[1-9]\d*)(?:-((?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*)(?:\.(?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*))*))?(?:\+([0-9a-zA-Z-]+(?:\.[0-9a-zA-Z-]+)*))?$` // numbered capture groups https://semver.org/
-	dnsRegexStringRFC1035Label       = "^[a-z]([-a-z0-9]*[a-z0-9])?$"
+	dnsRegexStringRFC1035Label       = "^[a-z]([-a-z0-9]*[a-z0-9]){0,62}$"
 	cveRegexString                   = `^CVE-(1999|2\d{3})-(0[^0]\d{2}|0\d[^0]\d{1}|0\d{2}[^0]|[1-9]{1}\d{3,})$` // CVE Format Id https://cve.mitre.org/cve/identifiers/syntaxchange.html
 	mongodbIdRegexString             = "^[a-f\\d]{24}$"
 	mongodbConnStringRegexString     = "^mongodb(\\+srv)?:\\/\\/(([a-zA-Z\\d]+):([a-zA-Z\\d$:\\/?#\\[\\]@]+)@)?(([a-z\\d.-]+)(:[\\d]+)?)((,(([a-z\\d.-]+)(:(\\d+))?))*)?(\\/[a-zA-Z-_]{1,64})?(\\?(([a-zA-Z]+)=([a-zA-Z\\d]+))(&(([a-zA-Z\\d]+)=([a-zA-Z\\d]+))?)*)?$"
@@ -77,7 +77,6 @@ const (
 	spicedbIDRegexString             = `^(([a-zA-Z0-9/_|\-=+]{1,})|\*)$`
 	spicedbPermissionRegexString     = "^([a-z][a-z0-9_]{1,62}[a-z0-9])?$"
 	spicedbTypeRegexString           = "^([a-z][a-z0-9_]{1,61}[a-z0-9]/)?[a-z][a-z0-9_]{1,62}[a-z0-9]$"
-	einRegexString                   = "^(\\d{2}-\\d{7})$"
 )
 
 func lazyRegexCompile(str string) func() *regexp.Regexp {
@@ -161,5 +160,4 @@ var (
 	spicedbIDRegex             = lazyRegexCompile(spicedbIDRegexString)
 	spicedbPermissionRegex     = lazyRegexCompile(spicedbPermissionRegexString)
 	spicedbTypeRegex           = lazyRegexCompile(spicedbTypeRegexString)
-	einRegex                   = lazyRegexCompile(einRegexString)
 )

vendor/github.com/go-playground/validator/v10/struct_level.go

@@ -46,9 +46,9 @@ type StructLevel interface {
 	//
 	// NOTES:
 	//
-	// fieldName and structFieldName get appended to the existing
-	// namespace that validator is on. e.g. pass 'FirstName' or
-	// 'Names[0]' depending on the nesting
+	// fieldName and altName get appended to the existing namespace that
+	// validator is on. e.g. pass 'FirstName' or 'Names[0]' depending
+	// on the nesting
 	//
 	// tag can be an existing validation tag or just something you make up
 	// and process on the flip side it's up to you.

vendor/github.com/go-playground/validator/v10/translations/en/en.go

@@ -217,18 +217,17 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
 			customTransFunc: func(ut ut.Translator, fe validator.FieldError) string {
 				var err error
 				var t string
-				var f64 float64
+
 				var digits uint64
 				var kind reflect.Kind
 
-				fn := func() (err error) {
-					if idx := strings.Index(fe.Param(), "."); idx != -1 {
-						digits = uint64(len(fe.Param()[idx+1:]))
-					}
+				if idx := strings.Index(fe.Param(), "."); idx != -1 {
+					digits = uint64(len(fe.Param()[idx+1:]))
+				}
 
-					f64, err = strconv.ParseFloat(fe.Param(), 64)
-
-					return
+				f64, err := strconv.ParseFloat(fe.Param(), 64)
+				if err != nil {
+					goto END
 				}
 
 				kind = fe.Kind()
@@ -241,11 +240,6 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
 
 					var c string
 
-					err = fn()
-					if err != nil {
-						goto END
-					}
-
 					c, err = ut.C("min-string-character", f64, digits, ut.FmtNumber(f64, digits))
 					if err != nil {
 						goto END
@@ -256,11 +250,6 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
 				case reflect.Slice, reflect.Map, reflect.Array:
 					var c string
 
-					err = fn()
-					if err != nil {
-						goto END
-					}
-
 					c, err = ut.C("min-items-item", f64, digits, ut.FmtNumber(f64, digits))
 					if err != nil {
 						goto END
@@ -269,16 +258,6 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
 					t, err = ut.T("min-items", fe.Field(), c)
 
 				default:
-					if fe.Type() == reflect.TypeOf(time.Duration(0)) {
-						t, err = ut.T("min-number", fe.Field(), fe.Param())
-						goto END
-					}
-
-					err = fn()
-					if err != nil {
-						goto END
-					}
-
 					t, err = ut.T("min-number", fe.Field(), ut.FmtNumber(f64, digits))
 				}
 
@@ -326,18 +305,17 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
 			customTransFunc: func(ut ut.Translator, fe validator.FieldError) string {
 				var err error
 				var t string
-				var f64 float64
+
 				var digits uint64
 				var kind reflect.Kind
 
-				fn := func() (err error) {
-					if idx := strings.Index(fe.Param(), "."); idx != -1 {
-						digits = uint64(len(fe.Param()[idx+1:]))
-					}
+				if idx := strings.Index(fe.Param(), "."); idx != -1 {
+					digits = uint64(len(fe.Param()[idx+1:]))
+				}
 
-					f64, err = strconv.ParseFloat(fe.Param(), 64)
-
-					return
+				f64, err := strconv.ParseFloat(fe.Param(), 64)
+				if err != nil {
+					goto END
 				}
 
 				kind = fe.Kind()
@@ -350,11 +328,6 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
 
 					var c string
 
-					err = fn()
-					if err != nil {
-						goto END
-					}
-
 					c, err = ut.C("max-string-character", f64, digits, ut.FmtNumber(f64, digits))
 					if err != nil {
 						goto END
@@ -365,11 +338,6 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
 				case reflect.Slice, reflect.Map, reflect.Array:
 					var c string
 
-					err = fn()
-					if err != nil {
-						goto END
-					}
-
 					c, err = ut.C("max-items-item", f64, digits, ut.FmtNumber(f64, digits))
 					if err != nil {
 						goto END
@@ -378,16 +346,6 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
 					t, err = ut.T("max-items", fe.Field(), c)
 
 				default:
-					if fe.Type() == reflect.TypeOf(time.Duration(0)) {
-						t, err = ut.T("max-number", fe.Field(), fe.Param())
-						goto END
-					}
-
-					err = fn()
-					if err != nil {
-						goto END
-					}
-
 					t, err = ut.T("max-number", fe.Field(), ut.FmtNumber(f64, digits))
 				}
 

vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml

@@ -1,4 +1,5 @@
-version: 2
+# This is an example goreleaser.yaml file with some sane defaults.
+# Make sure to check the documentation at http://goreleaser.com
 
 builds:
   -
@@ -26,7 +27,16 @@ builds:
 archives:
   -
     id: cpuid
-    name_template: "cpuid-{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
+    name_template: "cpuid-{{ .Os }}_{{ .Arch }}_{{ .Version }}"
+    replacements:
+      aix: AIX
+      darwin: OSX
+      linux: Linux
+      windows: Windows
+      386: i386
+      amd64: x86_64
+      freebsd: FreeBSD
+      netbsd: NetBSD
     format_overrides:
       - goos: windows
         format: zip
@@ -34,6 +44,8 @@ archives:
       - LICENSE
 checksum:
   name_template: 'checksums.txt'
+snapshot:
+  name_template: "{{ .Tag }}-next"
 changelog:
   sort: asc
   filters:
@@ -46,7 +58,7 @@ changelog:
 
 nfpms:
   -
-    file_name_template: "cpuid_package_{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
+    file_name_template: "cpuid_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}"
     vendor: Klaus Post
     homepage: https://github.com/klauspost/cpuid
     maintainer: Klaus Post <klauspost@gmail.com>
@@ -55,3 +67,8 @@ nfpms:
     formats:
       - deb
       - rpm
+    replacements:
+      darwin: Darwin
+      linux: Linux
+      freebsd: FreeBSD
+      amd64: x86_64

vendor/github.com/klauspost/cpuid/v2/README.md

@@ -282,9 +282,7 @@ Exit Code 1
 | AMXINT8            | Tile computational operations on 8-bit integers                                                                                                                                    |
 | AMXFP16            | Tile computational operations on FP16 numbers                                                                                                                                      |
 | AMXFP8             | Tile computational operations on FP8 numbers                                                                                                                                      |
-| AMXCOMPLEX         | Tile computational operations on complex numbers                                                                                                                                   |
 | AMXTILE            | Tile architecture                                                                                                                                                                  |
-| AMXTF32            | Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile                                                                                                              |
 | APX_F              | Intel APX                                                                                                                                                                          |
 | AVX                | AVX functions                                                                                                                                                                      |
 | AVX10              | If set the Intel AVX10 Converged Vector ISA is supported                                                                                                                           |
@@ -482,16 +480,12 @@ Exit Code 1
 | DCPOP        | Data cache clean to Point of Persistence (DC CVAP)               |
 | EVTSTRM      | Generic timer                                                    |
 | FCMA         | Floatin point complex number addition and multiplication         |
-| FHM          | FMLAL and FMLSL instructions                                     |
 | FP           | Single-precision and double-precision floating point             |
 | FPHP         | Half-precision floating point                                    |
 | GPA          | Generic Pointer Authentication                                   |
 | JSCVT        | Javascript-style double->int convert (FJCVTZS)                   |
 | LRCPC        | Weaker release consistency (LDAPR, etc)                          |
 | PMULL        | Polynomial Multiply instructions (PMULL/PMULL2)                  |
-| RNDR         | Random Number instructions                                       |
-| TLB          | Outer Shareable and TLB range maintenance instructions           |
-| TS           | Flag manipulation instructions                                   |
 | SHA1         | SHA-1 instructions (SHA1C, etc)                                  |
 | SHA2         | SHA-2 instructions (SHA256H, etc)                                |
 | SHA3         | SHA-3 instructions (EOR3, RAXI, XAR, BCAX)                       |

vendor/github.com/klauspost/cpuid/v2/cpuid.go

@@ -83,8 +83,6 @@ const (
 	AMXINT8                              // Tile computational operations on 8-bit integers
 	AMXFP8                               // Tile computational operations on FP8 numbers
 	AMXTILE                              // Tile architecture
-	AMXTF32                              // Tile architecture
-	AMXCOMPLEX                           // Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile
 	APX_F                                // Intel APX
 	AVX                                  // AVX functions
 	AVX10                                // If set the Intel AVX10 Converged Vector ISA is supported
@@ -284,16 +282,12 @@ const (
 	DCPOP    // Data cache clean to Point of Persistence (DC CVAP)
 	EVTSTRM  // Generic timer
 	FCMA     // Floatin point complex number addition and multiplication
-	FHM      // FMLAL and FMLSL instructions
 	FP       // Single-precision and double-precision floating point
 	FPHP     // Half-precision floating point
 	GPA      // Generic Pointer Authentication
 	JSCVT    // Javascript-style double->int convert (FJCVTZS)
 	LRCPC    // Weaker release consistency (LDAPR, etc)
 	PMULL    // Polynomial Multiply instructions (PMULL/PMULL2)
-	RNDR     // Random Number instructions
-	TLB      // Outer Shareable and TLB range maintenance instructions
-	TS       // Flag manipulation instructions
 	SHA1     // SHA-1 instructions (SHA1C, etc)
 	SHA2     // SHA-2 instructions (SHA256H, etc)
 	SHA3     // SHA-3 instructions (EOR3, RAXI, XAR, BCAX)
@@ -538,7 +532,7 @@ func (c CPUInfo) Ia32TscAux() uint32 {
 	return ecx
 }
 
-// SveLengths returns arm SVE vector and predicate lengths in bits.
+// SveLengths returns arm SVE vector and predicate lengths.
 // Will return 0, 0 if SVE is not enabled or otherwise unable to detect.
 func (c CPUInfo) SveLengths() (vl, pl uint64) {
 	if !c.Has(SVE) {
@@ -1290,8 +1284,6 @@ func support() flagSet {
 		// CPUID.(EAX=7, ECX=1).EDX
 		fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
 		fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
-		fs.setIf(edx1&(1<<7) != 0, AMXTF32)
-		fs.setIf(edx1&(1<<8) != 0, AMXCOMPLEX)
 		fs.setIf(edx1&(1<<10) != 0, AVXVNNIINT16)
 		fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
 		fs.setIf(edx1&(1<<19) != 0, AVX10)

vendor/github.com/klauspost/cpuid/v2/detect_arm64.go

@@ -157,10 +157,6 @@ func addInfo(c *CPUInfo, safe bool) {
 	// x--------------------------------------------------x
 	// | Name                         |  bits   | visible |
 	// |--------------------------------------------------|
-	// | RNDR                         | [63-60] |    y    |
-	// |--------------------------------------------------|
-	// | TLB                          | [59-56] |    y    |
-	// |--------------------------------------------------|
 	// | TS                           | [55-52] |    y    |
 	// |--------------------------------------------------|
 	// | FHM                          | [51-48] |    y    |
@@ -186,10 +182,12 @@ func addInfo(c *CPUInfo, safe bool) {
 	// | AES                          | [7-4]   |    y    |
 	// x--------------------------------------------------x
 
-	f.setIf(instAttrReg0&(0xf<<60) != 0, RNDR)
-	f.setIf(instAttrReg0&(0xf<<56) != 0, TLB)
-	f.setIf(instAttrReg0&(0xf<<52) != 0, TS)
-	f.setIf(instAttrReg0&(0xf<<48) != 0, FHM)
+	// if instAttrReg0&(0xf<<52) != 0 {
+	// 	fmt.Println("TS")
+	// }
+	// if instAttrReg0&(0xf<<48) != 0 {
+	// 	fmt.Println("FHM")
+	// }
 	f.setIf(instAttrReg0&(0xf<<44) != 0, ASIMDDP)
 	f.setIf(instAttrReg0&(0xf<<40) != 0, SM4)
 	f.setIf(instAttrReg0&(0xf<<36) != 0, SM3)

vendor/github.com/klauspost/cpuid/v2/featureid_string.go

@@ -17,229 +17,223 @@ func _() {
 	_ = x[AMXINT8-7]
 	_ = x[AMXFP8-8]
 	_ = x[AMXTILE-9]
-	_ = x[AMXTF32-10]
-	_ = x[AMXCOMPLEX-11]
-	_ = x[APX_F-12]
-	_ = x[AVX-13]
-	_ = x[AVX10-14]
-	_ = x[AVX10_128-15]
-	_ = x[AVX10_256-16]
-	_ = x[AVX10_512-17]
-	_ = x[AVX2-18]
-	_ = x[AVX512BF16-19]
-	_ = x[AVX512BITALG-20]
-	_ = x[AVX512BW-21]
-	_ = x[AVX512CD-22]
-	_ = x[AVX512DQ-23]
-	_ = x[AVX512ER-24]
-	_ = x[AVX512F-25]
-	_ = x[AVX512FP16-26]
-	_ = x[AVX512IFMA-27]
-	_ = x[AVX512PF-28]
-	_ = x[AVX512VBMI-29]
-	_ = x[AVX512VBMI2-30]
-	_ = x[AVX512VL-31]
-	_ = x[AVX512VNNI-32]
-	_ = x[AVX512VP2INTERSECT-33]
-	_ = x[AVX512VPOPCNTDQ-34]
-	_ = x[AVXIFMA-35]
-	_ = x[AVXNECONVERT-36]
-	_ = x[AVXSLOW-37]
-	_ = x[AVXVNNI-38]
-	_ = x[AVXVNNIINT8-39]
-	_ = x[AVXVNNIINT16-40]
-	_ = x[BHI_CTRL-41]
-	_ = x[BMI1-42]
-	_ = x[BMI2-43]
-	_ = x[CETIBT-44]
-	_ = x[CETSS-45]
-	_ = x[CLDEMOTE-46]
-	_ = x[CLMUL-47]
-	_ = x[CLZERO-48]
-	_ = x[CMOV-49]
-	_ = x[CMPCCXADD-50]
-	_ = x[CMPSB_SCADBS_SHORT-51]
-	_ = x[CMPXCHG8-52]
-	_ = x[CPBOOST-53]
-	_ = x[CPPC-54]
-	_ = x[CX16-55]
-	_ = x[EFER_LMSLE_UNS-56]
-	_ = x[ENQCMD-57]
-	_ = x[ERMS-58]
-	_ = x[F16C-59]
-	_ = x[FLUSH_L1D-60]
-	_ = x[FMA3-61]
-	_ = x[FMA4-62]
-	_ = x[FP128-63]
-	_ = x[FP256-64]
-	_ = x[FSRM-65]
-	_ = x[FXSR-66]
-	_ = x[FXSROPT-67]
-	_ = x[GFNI-68]
-	_ = x[HLE-69]
-	_ = x[HRESET-70]
-	_ = x[HTT-71]
-	_ = x[HWA-72]
-	_ = x[HYBRID_CPU-73]
-	_ = x[HYPERVISOR-74]
-	_ = x[IA32_ARCH_CAP-75]
-	_ = x[IA32_CORE_CAP-76]
-	_ = x[IBPB-77]
-	_ = x[IBPB_BRTYPE-78]
-	_ = x[IBRS-79]
-	_ = x[IBRS_PREFERRED-80]
-	_ = x[IBRS_PROVIDES_SMP-81]
-	_ = x[IBS-82]
-	_ = x[IBSBRNTRGT-83]
-	_ = x[IBSFETCHSAM-84]
-	_ = x[IBSFFV-85]
-	_ = x[IBSOPCNT-86]
-	_ = x[IBSOPCNTEXT-87]
-	_ = x[IBSOPSAM-88]
-	_ = x[IBSRDWROPCNT-89]
-	_ = x[IBSRIPINVALIDCHK-90]
-	_ = x[IBS_FETCH_CTLX-91]
-	_ = x[IBS_OPDATA4-92]
-	_ = x[IBS_OPFUSE-93]
-	_ = x[IBS_PREVENTHOST-94]
-	_ = x[IBS_ZEN4-95]
-	_ = x[IDPRED_CTRL-96]
-	_ = x[INT_WBINVD-97]
-	_ = x[INVLPGB-98]
-	_ = x[KEYLOCKER-99]
-	_ = x[KEYLOCKERW-100]
-	_ = x[LAHF-101]
-	_ = x[LAM-102]
-	_ = x[LBRVIRT-103]
-	_ = x[LZCNT-104]
-	_ = x[MCAOVERFLOW-105]
-	_ = x[MCDT_NO-106]
-	_ = x[MCOMMIT-107]
-	_ = x[MD_CLEAR-108]
-	_ = x[MMX-109]
-	_ = x[MMXEXT-110]
-	_ = x[MOVBE-111]
-	_ = x[MOVDIR64B-112]
-	_ = x[MOVDIRI-113]
-	_ = x[MOVSB_ZL-114]
-	_ = x[MOVU-115]
-	_ = x[MPX-116]
-	_ = x[MSRIRC-117]
-	_ = x[MSRLIST-118]
-	_ = x[MSR_PAGEFLUSH-119]
-	_ = x[NRIPS-120]
-	_ = x[NX-121]
-	_ = x[OSXSAVE-122]
-	_ = x[PCONFIG-123]
-	_ = x[POPCNT-124]
-	_ = x[PPIN-125]
-	_ = x[PREFETCHI-126]
-	_ = x[PSFD-127]
-	_ = x[RDPRU-128]
-	_ = x[RDRAND-129]
-	_ = x[RDSEED-130]
-	_ = x[RDTSCP-131]
-	_ = x[RRSBA_CTRL-132]
-	_ = x[RTM-133]
-	_ = x[RTM_ALWAYS_ABORT-134]
-	_ = x[SBPB-135]
-	_ = x[SERIALIZE-136]
-	_ = x[SEV-137]
-	_ = x[SEV_64BIT-138]
-	_ = x[SEV_ALTERNATIVE-139]
-	_ = x[SEV_DEBUGSWAP-140]
-	_ = x[SEV_ES-141]
-	_ = x[SEV_RESTRICTED-142]
-	_ = x[SEV_SNP-143]
-	_ = x[SGX-144]
-	_ = x[SGXLC-145]
-	_ = x[SHA-146]
-	_ = x[SME-147]
-	_ = x[SME_COHERENT-148]
-	_ = x[SPEC_CTRL_SSBD-149]
-	_ = x[SRBDS_CTRL-150]
-	_ = x[SRSO_MSR_FIX-151]
-	_ = x[SRSO_NO-152]
-	_ = x[SRSO_USER_KERNEL_NO-153]
-	_ = x[SSE-154]
-	_ = x[SSE2-155]
-	_ = x[SSE3-156]
-	_ = x[SSE4-157]
-	_ = x[SSE42-158]
-	_ = x[SSE4A-159]
-	_ = x[SSSE3-160]
-	_ = x[STIBP-161]
-	_ = x[STIBP_ALWAYSON-162]
-	_ = x[STOSB_SHORT-163]
-	_ = x[SUCCOR-164]
-	_ = x[SVM-165]
-	_ = x[SVMDA-166]
-	_ = x[SVMFBASID-167]
-	_ = x[SVML-168]
-	_ = x[SVMNP-169]
-	_ = x[SVMPF-170]
-	_ = x[SVMPFT-171]
-	_ = x[SYSCALL-172]
-	_ = x[SYSEE-173]
-	_ = x[TBM-174]
-	_ = x[TDX_GUEST-175]
-	_ = x[TLB_FLUSH_NESTED-176]
-	_ = x[TME-177]
-	_ = x[TOPEXT-178]
-	_ = x[TSCRATEMSR-179]
-	_ = x[TSXLDTRK-180]
-	_ = x[VAES-181]
-	_ = x[VMCBCLEAN-182]
-	_ = x[VMPL-183]
-	_ = x[VMSA_REGPROT-184]
-	_ = x[VMX-185]
-	_ = x[VPCLMULQDQ-186]
-	_ = x[VTE-187]
-	_ = x[WAITPKG-188]
-	_ = x[WBNOINVD-189]
-	_ = x[WRMSRNS-190]
-	_ = x[X87-191]
-	_ = x[XGETBV1-192]
-	_ = x[XOP-193]
-	_ = x[XSAVE-194]
-	_ = x[XSAVEC-195]
-	_ = x[XSAVEOPT-196]
-	_ = x[XSAVES-197]
-	_ = x[AESARM-198]
-	_ = x[ARMCPUID-199]
-	_ = x[ASIMD-200]
-	_ = x[ASIMDDP-201]
-	_ = x[ASIMDHP-202]
-	_ = x[ASIMDRDM-203]
-	_ = x[ATOMICS-204]
-	_ = x[CRC32-205]
-	_ = x[DCPOP-206]
-	_ = x[EVTSTRM-207]
-	_ = x[FCMA-208]
-	_ = x[FHM-209]
-	_ = x[FP-210]
-	_ = x[FPHP-211]
-	_ = x[GPA-212]
-	_ = x[JSCVT-213]
-	_ = x[LRCPC-214]
-	_ = x[PMULL-215]
-	_ = x[RNDR-216]
-	_ = x[TLB-217]
-	_ = x[TS-218]
-	_ = x[SHA1-219]
-	_ = x[SHA2-220]
-	_ = x[SHA3-221]
-	_ = x[SHA512-222]
-	_ = x[SM3-223]
-	_ = x[SM4-224]
-	_ = x[SVE-225]
-	_ = x[lastID-226]
+	_ = x[APX_F-10]
+	_ = x[AVX-11]
+	_ = x[AVX10-12]
+	_ = x[AVX10_128-13]
+	_ = x[AVX10_256-14]
+	_ = x[AVX10_512-15]
+	_ = x[AVX2-16]
+	_ = x[AVX512BF16-17]
+	_ = x[AVX512BITALG-18]
+	_ = x[AVX512BW-19]
+	_ = x[AVX512CD-20]
+	_ = x[AVX512DQ-21]
+	_ = x[AVX512ER-22]
+	_ = x[AVX512F-23]
+	_ = x[AVX512FP16-24]
+	_ = x[AVX512IFMA-25]
+	_ = x[AVX512PF-26]
+	_ = x[AVX512VBMI-27]
+	_ = x[AVX512VBMI2-28]
+	_ = x[AVX512VL-29]
+	_ = x[AVX512VNNI-30]
+	_ = x[AVX512VP2INTERSECT-31]
+	_ = x[AVX512VPOPCNTDQ-32]
+	_ = x[AVXIFMA-33]
+	_ = x[AVXNECONVERT-34]
+	_ = x[AVXSLOW-35]
+	_ = x[AVXVNNI-36]
+	_ = x[AVXVNNIINT8-37]
+	_ = x[AVXVNNIINT16-38]
+	_ = x[BHI_CTRL-39]
+	_ = x[BMI1-40]
+	_ = x[BMI2-41]
+	_ = x[CETIBT-42]
+	_ = x[CETSS-43]
+	_ = x[CLDEMOTE-44]
+	_ = x[CLMUL-45]
+	_ = x[CLZERO-46]
+	_ = x[CMOV-47]
+	_ = x[CMPCCXADD-48]
+	_ = x[CMPSB_SCADBS_SHORT-49]
+	_ = x[CMPXCHG8-50]
+	_ = x[CPBOOST-51]
+	_ = x[CPPC-52]
+	_ = x[CX16-53]
+	_ = x[EFER_LMSLE_UNS-54]
+	_ = x[ENQCMD-55]
+	_ = x[ERMS-56]
+	_ = x[F16C-57]
+	_ = x[FLUSH_L1D-58]
+	_ = x[FMA3-59]
+	_ = x[FMA4-60]
+	_ = x[FP128-61]
+	_ = x[FP256-62]
+	_ = x[FSRM-63]
+	_ = x[FXSR-64]
+	_ = x[FXSROPT-65]
+	_ = x[GFNI-66]
+	_ = x[HLE-67]
+	_ = x[HRESET-68]
+	_ = x[HTT-69]
+	_ = x[HWA-70]
+	_ = x[HYBRID_CPU-71]
+	_ = x[HYPERVISOR-72]
+	_ = x[IA32_ARCH_CAP-73]
+	_ = x[IA32_CORE_CAP-74]
+	_ = x[IBPB-75]
+	_ = x[IBPB_BRTYPE-76]
+	_ = x[IBRS-77]
+	_ = x[IBRS_PREFERRED-78]
+	_ = x[IBRS_PROVIDES_SMP-79]
+	_ = x[IBS-80]
+	_ = x[IBSBRNTRGT-81]
+	_ = x[IBSFETCHSAM-82]
+	_ = x[IBSFFV-83]
+	_ = x[IBSOPCNT-84]
+	_ = x[IBSOPCNTEXT-85]
+	_ = x[IBSOPSAM-86]
+	_ = x[IBSRDWROPCNT-87]
+	_ = x[IBSRIPINVALIDCHK-88]
+	_ = x[IBS_FETCH_CTLX-89]
+	_ = x[IBS_OPDATA4-90]
+	_ = x[IBS_OPFUSE-91]
+	_ = x[IBS_PREVENTHOST-92]
+	_ = x[IBS_ZEN4-93]
+	_ = x[IDPRED_CTRL-94]
+	_ = x[INT_WBINVD-95]
+	_ = x[INVLPGB-96]
+	_ = x[KEYLOCKER-97]
+	_ = x[KEYLOCKERW-98]
+	_ = x[LAHF-99]
+	_ = x[LAM-100]
+	_ = x[LBRVIRT-101]
+	_ = x[LZCNT-102]
+	_ = x[MCAOVERFLOW-103]
+	_ = x[MCDT_NO-104]
+	_ = x[MCOMMIT-105]
+	_ = x[MD_CLEAR-106]
+	_ = x[MMX-107]
+	_ = x[MMXEXT-108]
+	_ = x[MOVBE-109]
+	_ = x[MOVDIR64B-110]
+	_ = x[MOVDIRI-111]
+	_ = x[MOVSB_ZL-112]
+	_ = x[MOVU-113]
+	_ = x[MPX-114]
+	_ = x[MSRIRC-115]
+	_ = x[MSRLIST-116]
+	_ = x[MSR_PAGEFLUSH-117]
+	_ = x[NRIPS-118]
+	_ = x[NX-119]
+	_ = x[OSXSAVE-120]
+	_ = x[PCONFIG-121]
+	_ = x[POPCNT-122]
+	_ = x[PPIN-123]
+	_ = x[PREFETCHI-124]
+	_ = x[PSFD-125]
+	_ = x[RDPRU-126]
+	_ = x[RDRAND-127]
+	_ = x[RDSEED-128]
+	_ = x[RDTSCP-129]
+	_ = x[RRSBA_CTRL-130]
+	_ = x[RTM-131]
+	_ = x[RTM_ALWAYS_ABORT-132]
+	_ = x[SBPB-133]
+	_ = x[SERIALIZE-134]
+	_ = x[SEV-135]
+	_ = x[SEV_64BIT-136]
+	_ = x[SEV_ALTERNATIVE-137]
+	_ = x[SEV_DEBUGSWAP-138]
+	_ = x[SEV_ES-139]
+	_ = x[SEV_RESTRICTED-140]
+	_ = x[SEV_SNP-141]
+	_ = x[SGX-142]
+	_ = x[SGXLC-143]
+	_ = x[SHA-144]
+	_ = x[SME-145]
+	_ = x[SME_COHERENT-146]
+	_ = x[SPEC_CTRL_SSBD-147]
+	_ = x[SRBDS_CTRL-148]
+	_ = x[SRSO_MSR_FIX-149]
+	_ = x[SRSO_NO-150]
+	_ = x[SRSO_USER_KERNEL_NO-151]
+	_ = x[SSE-152]
+	_ = x[SSE2-153]
+	_ = x[SSE3-154]
+	_ = x[SSE4-155]
+	_ = x[SSE42-156]
+	_ = x[SSE4A-157]
+	_ = x[SSSE3-158]
+	_ = x[STIBP-159]
+	_ = x[STIBP_ALWAYSON-160]
+	_ = x[STOSB_SHORT-161]
+	_ = x[SUCCOR-162]
+	_ = x[SVM-163]
+	_ = x[SVMDA-164]
+	_ = x[SVMFBASID-165]
+	_ = x[SVML-166]
+	_ = x[SVMNP-167]
+	_ = x[SVMPF-168]
+	_ = x[SVMPFT-169]
+	_ = x[SYSCALL-170]
+	_ = x[SYSEE-171]
+	_ = x[TBM-172]
+	_ = x[TDX_GUEST-173]
+	_ = x[TLB_FLUSH_NESTED-174]
+	_ = x[TME-175]
+	_ = x[TOPEXT-176]
+	_ = x[TSCRATEMSR-177]
+	_ = x[TSXLDTRK-178]
+	_ = x[VAES-179]
+	_ = x[VMCBCLEAN-180]
+	_ = x[VMPL-181]
+	_ = x[VMSA_REGPROT-182]
+	_ = x[VMX-183]
+	_ = x[VPCLMULQDQ-184]
+	_ = x[VTE-185]
+	_ = x[WAITPKG-186]
+	_ = x[WBNOINVD-187]
+	_ = x[WRMSRNS-188]
+	_ = x[X87-189]
+	_ = x[XGETBV1-190]
+	_ = x[XOP-191]
+	_ = x[XSAVE-192]
+	_ = x[XSAVEC-193]
+	_ = x[XSAVEOPT-194]
+	_ = x[XSAVES-195]
+	_ = x[AESARM-196]
+	_ = x[ARMCPUID-197]
+	_ = x[ASIMD-198]
+	_ = x[ASIMDDP-199]
+	_ = x[ASIMDHP-200]
+	_ = x[ASIMDRDM-201]
+	_ = x[ATOMICS-202]
+	_ = x[CRC32-203]
+	_ = x[DCPOP-204]
+	_ = x[EVTSTRM-205]
+	_ = x[FCMA-206]
+	_ = x[FP-207]
+	_ = x[FPHP-208]
+	_ = x[GPA-209]
+	_ = x[JSCVT-210]
+	_ = x[LRCPC-211]
+	_ = x[PMULL-212]
+	_ = x[SHA1-213]
+	_ = x[SHA2-214]
+	_ = x[SHA3-215]
+	_ = x[SHA512-216]
+	_ = x[SM3-217]
+	_ = x[SM4-218]
+	_ = x[SVE-219]
+	_ = x[lastID-220]
 	_ = x[firstID-0]
 }
 
-const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVElastID"
+const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
 
-var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 90, 93, 98, 107, 116, 125, 129, 139, 151, 159, 167, 175, 183, 190, 200, 210, 218, 228, 239, 247, 257, 275, 290, 297, 309, 316, 323, 334, 346, 354, 358, 362, 368, 373, 381, 386, 392, 396, 405, 423, 431, 438, 442, 446, 460, 466, 470, 474, 483, 487, 491, 496, 501, 505, 509, 516, 520, 523, 529, 532, 535, 545, 555, 568, 581, 585, 596, 600, 614, 631, 634, 644, 655, 661, 669, 680, 688, 700, 716, 730, 741, 751, 766, 774, 785, 795, 802, 811, 821, 825, 828, 835, 840, 851, 858, 865, 873, 876, 882, 887, 896, 903, 911, 915, 918, 924, 931, 944, 949, 951, 958, 965, 971, 975, 984, 988, 993, 999, 1005, 1011, 1021, 1024, 1040, 1044, 1053, 1056, 1065, 1080, 1093, 1099, 1113, 1120, 1123, 1128, 1131, 1134, 1146, 1160, 1170, 1182, 1189, 1208, 1211, 1215, 1219, 1223, 1228, 1233, 1238, 1243, 1257, 1268, 1274, 1277, 1282, 1291, 1295, 1300, 1305, 1311, 1318, 1323, 1326, 1335, 1351, 1354, 1360, 1370, 1378, 1382, 1391, 1395, 1407, 1410, 1420, 1423, 1430, 1438, 1445, 1448, 1455, 1458, 1463, 1469, 1477, 1483, 1489, 1497, 1502, 1509, 1516, 1524, 1531, 1536, 1541, 1548, 1552, 1555, 1557, 1561, 1564, 1569, 1574, 1579, 1583, 1586, 1588, 1592, 1596, 1600, 1606, 1609, 1612, 1615, 1621}
+var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 73, 76, 81, 90, 99, 108, 112, 122, 134, 142, 150, 158, 166, 173, 183, 193, 201, 211, 222, 230, 240, 258, 273, 280, 292, 299, 306, 317, 329, 337, 341, 345, 351, 356, 364, 369, 375, 379, 388, 406, 414, 421, 425, 429, 443, 449, 453, 457, 466, 470, 474, 479, 484, 488, 492, 499, 503, 506, 512, 515, 518, 528, 538, 551, 564, 568, 579, 583, 597, 614, 617, 627, 638, 644, 652, 663, 671, 683, 699, 713, 724, 734, 749, 757, 768, 778, 785, 794, 804, 808, 811, 818, 823, 834, 841, 848, 856, 859, 865, 870, 879, 886, 894, 898, 901, 907, 914, 927, 932, 934, 941, 948, 954, 958, 967, 971, 976, 982, 988, 994, 1004, 1007, 1023, 1027, 1036, 1039, 1048, 1063, 1076, 1082, 1096, 1103, 1106, 1111, 1114, 1117, 1129, 1143, 1153, 1165, 1172, 1191, 1194, 1198, 1202, 1206, 1211, 1216, 1221, 1226, 1240, 1251, 1257, 1260, 1265, 1274, 1278, 1283, 1288, 1294, 1301, 1306, 1309, 1318, 1334, 1337, 1343, 1353, 1361, 1365, 1374, 1378, 1390, 1393, 1403, 1406, 1413, 1421, 1428, 1431, 1438, 1441, 1446, 1452, 1460, 1466, 1472, 1480, 1485, 1492, 1499, 1507, 1514, 1519, 1524, 1531, 1535, 1537, 1541, 1544, 1549, 1554, 1559, 1563, 1567, 1571, 1577, 1580, 1583, 1586, 1592}
 
 func (i FeatureID) String() string {
 	if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {