mirror of
https://github.com/opencloud-eu/opencloud.git
synced 2026-09-12 13:49:13 -04:00
Compare commits
119
Commits
| Author | SHA1 | Date | |
|---|---|---|---|
|
|
31fa450980 | ||
|
|
e734f735ad | ||
|
|
9e78188f9a | ||
|
|
873ad0f5b4 | ||
|
|
39a499fc01 | ||
|
|
77b103bec0 | ||
|
|
fe5309a4a2 | ||
|
|
78bacea4f6 | ||
|
|
945c04d448 | ||
|
|
f208268bad | ||
|
|
186072998a | ||
|
|
7276ce1340 | ||
|
|
f23fe92fcd | ||
|
|
ad377042dc | ||
|
|
6af2ecfdde | ||
|
|
f6a6b9689e | ||
|
|
7f36d68cfc | ||
|
|
90d2f17315 | ||
|
|
ea8507cc9f | ||
|
|
a5ebc0adec | ||
|
|
a95d75813c | ||
|
|
b1268f49c3 | ||
|
|
2babc5a48b | ||
|
|
be13bac7f7 | ||
|
|
f2ee327295 | ||
|
|
94f5162633 | ||
|
|
7e9a7d8099 | ||
|
|
a4164da9ed | ||
|
|
6386dd4e18 | ||
|
|
32a28c47d9 | ||
|
|
7eae811b18 | ||
|
|
9b1a79f7d7 | ||
|
|
3ca9a59aaa | ||
|
|
58932bbe99 | ||
|
|
cf2318d607 | ||
|
|
8a3aeb5b98 | ||
|
|
d07608758b | ||
|
|
56753d5c46 | ||
|
|
58671abc6a | ||
|
|
5410caea4d | ||
|
|
d2d33e4d48 | ||
|
|
7c040b0b9d | ||
|
|
bd1fc8a70b | ||
|
|
882894d0e2 | ||
|
|
8290d8bf9d | ||
|
|
a86c6ea708 | ||
|
|
d7391a5bd5 | ||
|
|
45c3234332 | ||
|
|
d06cca6fab | ||
|
|
a2b6ebf750 | ||
|
|
077c3c0268 | ||
|
|
382c4228e2 | ||
|
|
e849dc345c | ||
|
|
0179d0e1ae | ||
|
|
87def992c8 | ||
|
|
c31d42bc7e | ||
|
|
862e306260 | ||
|
|
56636cc9c4 | ||
|
|
a484237fcc | ||
|
|
a98c63846c | ||
|
|
6fc05f592b | ||
|
|
7c5fb08262 | ||
|
|
2174942a93 | ||
|
|
a325586c85 | ||
|
|
9ec6e3eebf | ||
|
|
b5d87db137 | ||
|
|
ec3555e348 | ||
|
|
b1d08cb542 | ||
|
|
8278c079e4 | ||
|
|
b0f3ab6252 | ||
|
|
56c387cfa0 | ||
|
|
95ae1ea32a | ||
|
|
43677a0cd2 | ||
|
|
f25e191a46 | ||
|
|
4372244eeb | ||
|
|
8a8523c922 | ||
|
|
dea654edbc | ||
|
|
c2c0e61d5e | ||
|
|
c45b725182 | ||
|
|
e5e2626a11 | ||
|
|
6fcb47ce11 | ||
|
|
9949d4a57a | ||
|
|
d02c854971 | ||
|
|
91c2624c04 | ||
|
|
0636d906ac | ||
|
|
2609d0e589 | ||
|
|
4bbd46d238 | ||
|
|
90b67351cf | ||
|
|
3bcef42910 | ||
|
|
09818a9d7e | ||
|
|
3625eebe64 | ||
|
|
054c87b3fd | ||
|
|
b4a607965f | ||
|
|
37d6cd653d | ||
|
|
ff91a5014f | ||
|
|
1eb7683176 | ||
|
|
c73a552d52 | ||
|
|
822de1ad8e | ||
|
|
874601ab8f | ||
|
|
965a626a01 | ||
|
|
86354e6917 | ||
|
|
537b7056eb | ||
|
|
495cb289e7 | ||
|
|
dd30b5b53b | ||
|
|
034b5d2c4e | ||
|
|
ec43da4ed1 | ||
|
|
cb243448cc | ||
|
|
9feb51dd0d | ||
|
|
8c5af66b1f | ||
|
|
f0e62323cb | ||
|
|
2ffbb1f201 | ||
|
|
1607135488 | ||
|
|
85327e659c | ||
|
|
97ff296340 | ||
|
|
18e81d441a | ||
|
|
806fb8f1c4 | ||
|
|
c3e0fcc967 | ||
|
|
26e172cfad | ||
|
|
90e2221164 |
No files matched your search
@@ -4,8 +4,6 @@ on:
|
||||
types: [opened, labeled, unlabeled, synchronize]
|
||||
jobs:
|
||||
label:
|
||||
# Only run if PR is not from a fork
|
||||
if: github.event.pull_request.head.repo.full_name == github.repository
|
||||
runs-on: ubuntu-latest
|
||||
permissions:
|
||||
issues: write
|
||||
|
||||
+7
-8
@@ -18,21 +18,20 @@ SOURCES ?= $(shell find . -name "*.go" -type f -not -path "./node_modules/*")
|
||||
TAGS ?=
|
||||
|
||||
ifndef OUTPUT
|
||||
ifneq ($(DRONE_TAG),)
|
||||
OUTPUT ?= $(subst v,,$(DRONE_TAG))
|
||||
ifneq ($(CI_COMMIT_TAG),)
|
||||
OUTPUT ?= $(subst v,,$(CI_COMMIT_TAG))
|
||||
else
|
||||
OUTPUT ?= testing
|
||||
endif
|
||||
endif
|
||||
|
||||
ifndef VERSION
|
||||
ifneq ($(DRONE_TAG),)
|
||||
VERSION ?= $(subst v,,$(DRONE_TAG))
|
||||
else
|
||||
STRING ?= $(shell git rev-parse --short HEAD)
|
||||
endif
|
||||
ifeq ($(VERSION), daily)
|
||||
STRING ?= $(shell git rev-parse --short HEAD)
|
||||
else ifeq ($(VERSION),)
|
||||
STRING ?= $(shell git rev-parse --short HEAD)
|
||||
endif
|
||||
|
||||
|
||||
ifndef DATE
|
||||
DATE := $(shell date -u '+%Y%m%d')
|
||||
endif
|
||||
|
||||
+2
-2
@@ -1,3 +1,3 @@
|
||||
# The test runner source for UI tests
|
||||
WEB_COMMITID=59e329cc5fe288cf247cc5272547a77ac59cc000
|
||||
WEB_BRANCH=stable-2.1
|
||||
WEB_COMMITID=25629bf0d846051ec0ed6f56ddbeb1a4de6f9ba0
|
||||
WEB_BRANCH=main
|
||||
+192
-272
File diff suppressed because it is too large.
Load diff
+28
-36
@@ -1,53 +1,45 @@
|
||||
# Changelog
|
||||
|
||||
## [2.0.4](https://github.com/opencloud-eu/opencloud/releases/tag/v2.0.4) - 2025-07-11
|
||||
## [2.1.0](https://github.com/opencloud-eu/opencloud/releases/tag/v2.1.0) - 2025-04-07
|
||||
|
||||
### ❤️ Thanks to all contributors! ❤️
|
||||
|
||||
@micbar
|
||||
@AlexAndBear, @JammingBen, @ScharfViktor, @aduffeck, @butonic, @fschade, @individual-it, @kulmann, @micbar, @michaelstingl, @rhafer
|
||||
|
||||
### 🐛 Bug Fixes
|
||||
|
||||
- [Backport] fix: build_args is now an object [[#1213](https://github.com/opencloud-eu/opencloud/pull/1213)]
|
||||
- feat(antivirus): add partial scanning mode [[#559](https://github.com/opencloud-eu/opencloud/pull/559)]
|
||||
- Simplify item-trashed SSEs. Also fixes it for coll. posix fs. [[#565](https://github.com/opencloud-eu/opencloud/pull/565)]
|
||||
- fix(opencloud_full): add missing SMTP env vars [[#563](https://github.com/opencloud-eu/opencloud/pull/563)]
|
||||
- fix: full deployment tika description is wrong [[#553](https://github.com/opencloud-eu/opencloud/pull/553)]
|
||||
- fix: traefik credentials [[#555](https://github.com/opencloud-eu/opencloud/pull/555)]
|
||||
- Enable scan/watch in the storageprovider only [[#546](https://github.com/opencloud-eu/opencloud/pull/546)]
|
||||
- fix: typo in dev docs [[#540](https://github.com/opencloud-eu/opencloud/pull/540)]
|
||||
|
||||
## [2.0.3](https://github.com/opencloud-eu/opencloud/releases/tag/v2.0.3) - 2025-07-10
|
||||
### 📈 Enhancement
|
||||
|
||||
### ❤️ Thanks to all contributors! ❤️
|
||||
- [full-ci] reva bump 2.31.0 [[#599](https://github.com/opencloud-eu/opencloud/pull/599)]
|
||||
- feat: support svg as icon [[#538](https://github.com/opencloud-eu/opencloud/pull/538)]
|
||||
- feat: change theme.json primary color [[#536](https://github.com/opencloud-eu/opencloud/pull/536)]
|
||||
- graph: reduce memory allocations [[#494](https://github.com/opencloud-eu/opencloud/pull/494)]
|
||||
|
||||
@ScharfViktor
|
||||
### ✅ Tests
|
||||
|
||||
- [full-ci] fix expected spanish string in test [[#596](https://github.com/opencloud-eu/opencloud/pull/596)]
|
||||
- Revert "Disable the 'exclude' patterns on the path conditional for now" [[#561](https://github.com/opencloud-eu/opencloud/pull/561)]
|
||||
|
||||
### 📦️ Dependencies
|
||||
|
||||
- [full-ci] Reva bump 2.29.4 [[#1202](https://github.com/opencloud-eu/opencloud/pull/1202)]
|
||||
|
||||
## [2.0.2](https://github.com/opencloud-eu/opencloud/releases/tag/v2.0.2) - 2025-05-02
|
||||
|
||||
### ❤️ Thanks to all contributors! ❤️
|
||||
|
||||
@ScharfViktor
|
||||
|
||||
### 🐛 Bug Fixes
|
||||
|
||||
- Abort when the space root has already been created [[#766](https://github.com/opencloud-eu/opencloud/pull/766)]
|
||||
|
||||
## [2.0.1](https://github.com/opencloud-eu/opencloud/releases/tag/v2.0.1) - 2025-04-28
|
||||
|
||||
### ❤️ Thanks to all contributors! ❤️
|
||||
|
||||
@JammingBen, @ScharfViktor, @fschade, @micbar
|
||||
|
||||
### 🐛 Bug Fixes
|
||||
|
||||
- fix(decomposeds3): enable async-uploads by default (#686) [[#694](https://github.com/opencloud-eu/opencloud/pull/694)]
|
||||
- fix(antivirus | backport): introduce a default max scan size for the full example deployment [[#620](https://github.com/opencloud-eu/opencloud/pull/620)]
|
||||
- [full-ci] chore(web): bump web to v2.1.1 [[#638](https://github.com/opencloud-eu/opencloud/pull/638)]
|
||||
|
||||
### 📦️ Dependencies
|
||||
|
||||
- chore: prepare release, bump version [[#731](https://github.com/opencloud-eu/opencloud/pull/731)]
|
||||
- Port #567 [[#689](https://github.com/opencloud-eu/opencloud/pull/689)]
|
||||
- chore: bump reva to v2.29.2 [[#681](https://github.com/opencloud-eu/opencloud/pull/681)]
|
||||
- build(deps): bump github.com/nats-io/nats-server/v2 [[#683](https://github.com/opencloud-eu/opencloud/pull/683)]
|
||||
- build(deps): bump github.com/go-playground/validator/v10 from 10.25.0 to 10.26.0 [[#571](https://github.com/opencloud-eu/opencloud/pull/571)]
|
||||
- build(deps): bump github.com/nats-io/nats.go from 1.39.1 to 1.41.0 [[#567](https://github.com/opencloud-eu/opencloud/pull/567)]
|
||||
- [full-ci] chore(web): bump web to v2.2.0 [[#570](https://github.com/opencloud-eu/opencloud/pull/570)]
|
||||
- build(deps): bump github.com/onsi/gomega from 1.36.3 to 1.37.0 [[#566](https://github.com/opencloud-eu/opencloud/pull/566)]
|
||||
- build(deps): bump golang.org/x/net from 0.37.0 to 0.38.0 [[#557](https://github.com/opencloud-eu/opencloud/pull/557)]
|
||||
- build(deps-dev): bump eslint-plugin-jsx-a11y from 6.9.0 to 6.10.2 in /services/idp [[#542](https://github.com/opencloud-eu/opencloud/pull/542)]
|
||||
- build(deps): bump web-vitals from 3.5.2 to 4.2.4 in /services/idp [[#541](https://github.com/opencloud-eu/opencloud/pull/541)]
|
||||
- build(deps): bump github.com/open-policy-agent/opa from 1.2.0 to 1.3.0 [[#508](https://github.com/opencloud-eu/opencloud/pull/508)]
|
||||
- build(deps): bump github.com/urfave/cli/v2 from 2.27.5 to 2.27.6 [[#509](https://github.com/opencloud-eu/opencloud/pull/509)]
|
||||
- fix keycloak example #465 [[#535](https://github.com/opencloud-eu/opencloud/pull/535)]
|
||||
|
||||
## [2.0.0](https://github.com/opencloud-eu/opencloud/releases/tag/v2.0.0) - 2025-03-26
|
||||
|
||||
|
||||
@@ -1,6 +1,6 @@
|
||||

|
||||
|
||||
[](https://ci.opencloud.eu/repos/3/branches/stable-2.0)
|
||||
[](https://ci.opencloud.eu/repos/3)
|
||||
[](https://app.element.io/#/room/#opencloud:matrix.org)
|
||||
[](https://opensource.org/licenses/Apache-2.0)
|
||||
|
||||
|
||||
@@ -26,14 +26,26 @@ This script should **NOT** be run as user root.
|
||||
Set the environment variable `OC_VERSION` to the version you want
|
||||
to download. If not set, there is a reasonable default.
|
||||
|
||||
## Data Location
|
||||
|
||||
Set the environment variable `OC_BASE_DIR` to a directory where the
|
||||
`data` and `config` subdirectories shall be located. Per default,
|
||||
both configuration and storage data are within a sandbox subdirectory
|
||||
in the current working directory.
|
||||
|
||||
## Server Address
|
||||
|
||||
Set the environment variable `OC_HOST` to the fully qualified hostname
|
||||
of this server to allow remote accesse. Default: `localhost`.
|
||||
|
||||
# Example
|
||||
|
||||
Call
|
||||
|
||||
```
|
||||
OC_VERSION="1.0.0" ./install.sh
|
||||
OC_VERSION="2.0.0" ./install.sh
|
||||
```
|
||||
to install the OpenCloud version 1.0.0
|
||||
to install the OpenCloud version 2.0.0
|
||||
|
||||
There is also a hosted version of this script that makes it even
|
||||
easier:
|
||||
|
||||
@@ -37,7 +37,7 @@ function backup_file () {
|
||||
# URL pattern of the download file
|
||||
# https://github.com/opencloud-eu/opencloud/releases/download/v1.0.0/opencloud-1.0.0-linux-amd64
|
||||
|
||||
dlversion="${OC_VERSION:-1.1.0}"
|
||||
dlversion="${OC_VERSION:-2.0.0}"
|
||||
dlurl="https://github.com/opencloud-eu/opencloud/releases/download/v${dlversion}/"
|
||||
|
||||
sandbox="opencloud-sandbox-${dlversion}"
|
||||
@@ -69,14 +69,14 @@ echo "Downloading ${dlurl}/${dlfile}"
|
||||
curl -L -o "${dlfile}" --progress-bar "${dlurl}/${dlfile}"
|
||||
chmod 755 ${dlfile}
|
||||
|
||||
mkdir data config
|
||||
|
||||
export OC_CONFIG_DIR="$(pwd)/config"
|
||||
export OC_BASE_DATA_PATH="$(pwd)/data"
|
||||
basedir="${OC_BASE_DIR:-$(pwd)}"
|
||||
export OC_CONFIG_DIR="$basedir/config"
|
||||
export OC_BASE_DATA_PATH="$basedir/data"
|
||||
mkdir -p "$OC_CONFIG_DIR" "$OC_BASE_DATA_PATH"
|
||||
|
||||
# It is bound to localhost for now to deal with non existing routes
|
||||
# to certain host names for example in WSL
|
||||
host="localhost"
|
||||
host="${OC_HOST:-localhost}"
|
||||
|
||||
./${dlfile} init --insecure yes --ap admin
|
||||
|
||||
|
||||
@@ -17,7 +17,9 @@ TRAEFIK_DASHBOARD=
|
||||
# Defaults to "traefik.opencloud.test"
|
||||
TRAEFIK_DOMAIN=
|
||||
# Basic authentication for the traefik dashboard.
|
||||
# Defaults to user "admin" and password "admin" (written as: "admin:admin").
|
||||
# Defaults to user "admin" and password "admin" (written as: "admin:$2y$05$KDHu3xq92SPaO3G8Ybkc7edd51pPLJcG1nWk3lmlrIdANQ/B6r5pq").
|
||||
# To create user:password pair, it's possible to use this command:
|
||||
# echo $(htpasswd -nB user) | sed -e s/\\$/\\$\\$/g
|
||||
TRAEFIK_BASIC_AUTH_USERS=
|
||||
# Email address for obtaining LetsEncrypt certificates.
|
||||
# Needs only be changed if this is a public facing server.
|
||||
@@ -62,6 +64,8 @@ LOG_LEVEL=
|
||||
# LOG_PRETTY=true
|
||||
#
|
||||
# Define the openCloud storage location. Set the paths for config and data to a local path.
|
||||
# Ensure that the configuration and data directories are owned by the user and group with ID 1000:1000.
|
||||
# This matches the default user inside the container and avoids permission issues when accessing files.
|
||||
# Note that especially the data directory can grow big.
|
||||
# Leaving it default stores data in docker internal volumes.
|
||||
# OC_CONFIG_DIR=/your/local/opencloud/config
|
||||
@@ -98,7 +102,7 @@ MINIO_DOMAIN=
|
||||
# Note: the leading colon is required to enable the service.
|
||||
#DECOMPOSED=:decomposed.yml
|
||||
|
||||
# Define SMPT settings if you would like to send OpenCloud email notifications.
|
||||
# Define SMTP settings if you would like to send OpenCloud email notifications.
|
||||
#
|
||||
# NOTE: when configuring Inbucket, these settings have no effect, see inbucket.yml for details.
|
||||
# SMTP host to connect to.
|
||||
@@ -114,6 +118,8 @@ SMTP_USERNAME=
|
||||
SMTP_PASSWORD=
|
||||
# Authentication method for the SMTP communication.
|
||||
SMTP_AUTHENTICATION=
|
||||
# Encryption method for the SMTP communication. Possible values are 'starttls', 'ssltls' and 'none'
|
||||
SMTP_TRANSPORT_ENCRYPTION=
|
||||
# Allow insecure connections to the SMTP server. Defaults to false.
|
||||
SMTP_INSECURE=
|
||||
|
||||
@@ -157,7 +163,7 @@ COMPANION_ONEDRIVE_SECRET=
|
||||
## Default Enabled Services ##
|
||||
|
||||
### Apache Tika Content Analysis Toolkit ###
|
||||
# Tika (search) is enabled by default, comment if not required.
|
||||
# Tika (search) is disabled by default due to performance reasons.
|
||||
# Note: the leading colon is required to enable the service.
|
||||
#TIKA=:tika.yml
|
||||
# Set the desired docker image tag or digest.
|
||||
@@ -214,6 +220,9 @@ COLLABORA_SSL_VERIFICATION=false
|
||||
# Usable common abbreviations: [KB, KiB, MB, MiB, GB, GiB, TB, TiB, PB, PiB, EB, EiB], example: 2GB.
|
||||
# Defaults to "100MB"
|
||||
#ANTIVIRUS_MAX_SCAN_SIZE=
|
||||
# Usable modes: partial, skip.
|
||||
# Defaults to "partial"
|
||||
#ANTIVIRUS_MAX_SCAN_SIZE_MODE=
|
||||
# Image version of the ClamAV container.
|
||||
# Defaults to "latest"
|
||||
CLAMAV_DOCKER_TAG=
|
||||
@@ -241,8 +250,31 @@ INBUCKET_DOMAIN=
|
||||
# Path separator for supplemental compose files specified in COMPOSE_FILE.
|
||||
COMPOSE_PATH_SEPARATOR=:
|
||||
|
||||
### Keycloak Settings ###
|
||||
# Note: the leading colon is required to enable the service.
|
||||
#KEYCLOAK=:keycloak.yml
|
||||
# Domain for Keycloak. Defaults to "keycloak.opencloud.test".
|
||||
KEYCLOAK_DOMAIN=
|
||||
# Realm which to be used with OpenCloud. Defaults to "OpenCloud"
|
||||
KEYCLOAK_REALM=
|
||||
# Admin user login name. Defaults to "admin"
|
||||
KEYCLOAK_ADMIN_USER=
|
||||
# Admin user login password. Defaults to "admin"
|
||||
KEYCLOAK_ADMIN_PASSWORD=
|
||||
|
||||
### Ldap Settings ###
|
||||
# Note: the leading colon is required to enable the service.
|
||||
#LDAP=:ldap.yml
|
||||
# Password of LDAP user "cn=admin,dc=opencloud,dc=eu". Defaults to "admin"
|
||||
LDAP_ADMIN_PASSWORD=
|
||||
# LDAP manager
|
||||
# login with uid ldapadmin and password
|
||||
#LDAP_MANAGER=:../shared/config/ldap/docker-compose.yml
|
||||
# LDAP manager domain. Defaults to "ldap.opencloud.test"
|
||||
LDAP_MANAGER_DOMAIN=
|
||||
|
||||
## IMPORTANT ##
|
||||
# This MUST be the last line as it assembles the supplemental compose files to be used.
|
||||
# ALL supplemental configs must be added here, whether commented or not.
|
||||
# Each var must either be empty or contain :path/file.yml
|
||||
COMPOSE_FILE=docker-compose.yml${OPENCLOUD:-}${TIKA:-}${DECOMPOSEDS3:-}${DECOMPOSEDS3_MINIO:-}${DECOMPOSED:-}${COLLABORA:-}${MONITORING:-}${IMPORTER:-}${CLAMAV:-}${ONLYOFFICE:-}${INBUCKET:-}${EXTENSIONS:-}${UNZIP:-}${DRAWIO:-}${JSONVIEWER:-}${PROGRESSBARS:-}${EXTERNALSITES:-}
|
||||
COMPOSE_FILE=docker-compose.yml${OPENCLOUD:-}${TIKA:-}${DECOMPOSEDS3:-}${DECOMPOSEDS3_MINIO:-}${DECOMPOSED:-}${COLLABORA:-}${MONITORING:-}${IMPORTER:-}${CLAMAV:-}${ONLYOFFICE:-}${INBUCKET:-}${EXTENSIONS:-}${UNZIP:-}${DRAWIO:-}${JSONVIEWER:-}${PROGRESSBARS:-}${EXTERNALSITES:-}${KEYCLOAK:-}${LDAP:-}${LDAP_MANAGER:-}
|
||||
@@ -4,6 +4,7 @@ services:
|
||||
environment:
|
||||
ANTIVIRUS_SCANNER_TYPE: "clamav"
|
||||
ANTIVIRUS_CLAMAV_SOCKET: "/var/run/clamav/clamd.sock"
|
||||
ANTIVIRUS_MAX_SCAN_SIZE_MODE: ${ANTIVIRUS_MAX_SCAN_SIZE_MODE:-partial}
|
||||
ANTIVIRUS_MAX_SCAN_SIZE: ${ANTIVIRUS_MAX_SCAN_SIZE:-100MB}
|
||||
# the antivirus service needs manual startup, see .env and opencloud.yaml for START_ADDITIONAL_SERVICES
|
||||
# configure the antivirus service
|
||||
|
||||
@@ -0,0 +1,63 @@
|
||||
{
|
||||
"clientId": "OpenCloudAndroid",
|
||||
"name": "OpenCloud Android App",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"oc://android.opencloud.eu"
|
||||
],
|
||||
"webOrigins": [],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"post.logout.redirect.uris": "oc://android.opencloud.eu",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -0,0 +1,64 @@
|
||||
{
|
||||
"clientId": "OpenCloudDesktop",
|
||||
"name": "OpenCloud Desktop Client",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"http://127.0.0.1",
|
||||
"http://localhost"
|
||||
],
|
||||
"webOrigins": [],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"post.logout.redirect.uris": "+",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -0,0 +1,63 @@
|
||||
{
|
||||
"clientId": "OpenCloudIOS",
|
||||
"name": "OpenCloud iOS App",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"oc://ios.opencloud.eu"
|
||||
],
|
||||
"webOrigins": [],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"post.logout.redirect.uris": "oc://ios.opencloud.eu",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -0,0 +1,66 @@
|
||||
{
|
||||
"clientId": "Cyberduck",
|
||||
"name": "Cyberduck",
|
||||
"description": "File transfer utility client",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"x-cyberduck-action:oauth",
|
||||
"x-mountainduck-action:oauth"
|
||||
],
|
||||
"webOrigins": [],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"oauth2.device.authorization.grant.enabled": "false",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"oidc.ciba.grant.enabled": "false",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -0,0 +1,74 @@
|
||||
{
|
||||
"clientId": "web",
|
||||
"name": "OpenCloud Web App",
|
||||
"description": "",
|
||||
"rootUrl": "{{OC_URL}}",
|
||||
"adminUrl": "{{OC_URL}}",
|
||||
"baseUrl": "",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"{{OC_URL}}/",
|
||||
"{{OC_URL}}/oidc-callback.html",
|
||||
"{{OC_URL}}/oidc-silent-redirect.html"
|
||||
],
|
||||
"webOrigins": [
|
||||
"{{OC_URL}}"
|
||||
],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"post.logout.redirect.uris": "+",
|
||||
"oauth2.device.authorization.grant.enabled": "false",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"oidc.ciba.grant.enabled": "false",
|
||||
"backchannel.logout.url": "{{OC_URL}}/backchannel_logout",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -0,0 +1,8 @@
|
||||
#!/bin/bash
|
||||
printenv
|
||||
# replace openCloud domain in keycloak realm import
|
||||
mkdir /opt/keycloak/data/import
|
||||
sed -e "s/cloud.opencloud.test/${OC_DOMAIN}/g" /opt/keycloak/data/import-dist/opencloud-realm.json > /opt/keycloak/data/import/opencloud-realm.json
|
||||
|
||||
# run original docker-entrypoint
|
||||
/opt/keycloak/bin/kc.sh "$@"
|
||||
File diff suppressed because it is too large.
Load diff
@@ -0,0 +1,9 @@
|
||||
#!/bin/bash
|
||||
printenv
|
||||
|
||||
if [ ! -f /opt/bitnami/openldap/share/openldap.key ]
|
||||
then
|
||||
openssl req -x509 -newkey rsa:4096 -keyout /opt/bitnami/openldap/share/openldap.key -out /opt/bitnami/openldap/share/openldap.crt -sha256 -days 365 -batch -nodes
|
||||
fi
|
||||
# run original docker-entrypoint
|
||||
/opt/bitnami/scripts/openldap/entrypoint.sh "$@"
|
||||
@@ -0,0 +1,20 @@
|
||||
dn: dc=opencloud,dc=eu
|
||||
objectClass: organization
|
||||
objectClass: dcObject
|
||||
dc: opencloud
|
||||
o: openCloud
|
||||
|
||||
dn: ou=users,dc=opencloud,dc=eu
|
||||
objectClass: organizationalUnit
|
||||
ou: users
|
||||
|
||||
dn: cn=admin,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: person
|
||||
cn: admin
|
||||
sn: admin
|
||||
uid: ldapadmin
|
||||
|
||||
dn: ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: organizationalUnit
|
||||
ou: groups
|
||||
@@ -0,0 +1,125 @@
|
||||
# Start dn with uid (user identifier / login), not cn (Firstname + Surname)
|
||||
dn: uid=alan,ou=users,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: organizationalPerson
|
||||
objectClass: openCloudUser
|
||||
objectClass: person
|
||||
objectClass: posixAccount
|
||||
objectClass: top
|
||||
uid: alan
|
||||
givenName: Alan
|
||||
sn: Turing
|
||||
cn: alan
|
||||
displayName: Alan Turing
|
||||
description: An English mathematician, computer scientist, logician, cryptanalyst, philosopher and theoretical biologist. He was highly influential in the development of theoretical computer science, providing a formalisation of the concepts of algorithm and computation with the Turing machine.
|
||||
mail: alan@example.org
|
||||
uidNumber: 20000
|
||||
gidNumber: 30000
|
||||
homeDirectory: /home/alan
|
||||
openCloudUUID: b1f74ec4-dd7e-11ef-a543-03775734d0f7
|
||||
userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
|
||||
|
||||
dn: uid=lynn,ou=users,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: organizationalPerson
|
||||
objectClass: openCloudUser
|
||||
objectClass: person
|
||||
objectClass: posixAccount
|
||||
objectClass: top
|
||||
uid: lynn
|
||||
givenName: Lynn
|
||||
sn: Conway
|
||||
cn: lynn
|
||||
displayName: Lynn Conway
|
||||
description: An American computer scientist, electrical engineer, and transgender activist.
|
||||
mail: lynn@example.org
|
||||
uidNumber: 20001
|
||||
gidNumber: 30000
|
||||
homeDirectory: /home/lynn
|
||||
openCloudUserEnabled: TRUE
|
||||
openCloudUUID: 60708dda-e897-11ef-919f-bbb7437d6ec2
|
||||
userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
|
||||
|
||||
dn: uid=mary,ou=users,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: organizationalPerson
|
||||
objectClass: openCloudUser
|
||||
objectClass: person
|
||||
objectClass: posixAccount
|
||||
objectClass: top
|
||||
uid: mary
|
||||
givenName: Mary
|
||||
sn: Kenneth Keller
|
||||
cn: mary
|
||||
displayName: Mary Kenneth Keller
|
||||
description: Mary Kenneth Keller of the Sisters of Charity of the Blessed Virgin Mary was a pioneer in computer science.
|
||||
mail: mary@example.org
|
||||
uidNumber: 20002
|
||||
gidNumber: 30000
|
||||
homeDirectory: /home/mary
|
||||
openCloudUserEnabled: TRUE
|
||||
openCloudUUID: 056fc874-dd7f-11ef-ba84-af6fca4b7289
|
||||
userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
|
||||
|
||||
dn: uid=margaret,ou=users,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: organizationalPerson
|
||||
objectClass: openCloudUser
|
||||
objectClass: person
|
||||
objectClass: posixAccount
|
||||
objectClass: top
|
||||
uid: margaret
|
||||
givenName: Margaret
|
||||
sn: Hamilton
|
||||
cn: margaret
|
||||
displayName: Margaret Hamilton
|
||||
description: A director of the Software Engineering Division of the MIT Instrumentation Laboratory, which developed on-board flight software for NASA's Apollo program.
|
||||
mail: margaret@example.org
|
||||
uidNumber: 20003
|
||||
gidNumber: 30000
|
||||
homeDirectory: /home/margaret
|
||||
openCloudUserEnabled: TRUE
|
||||
openCloudUUID: 801abee4-dd7f-11ef-a324-83f55a754b62
|
||||
userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
|
||||
|
||||
dn: uid=dennis,ou=users,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: organizationalPerson
|
||||
objectClass: openCloudUser
|
||||
objectClass: person
|
||||
objectClass: posixAccount
|
||||
objectClass: top
|
||||
uid: dennis
|
||||
givenName: Dennis
|
||||
sn: Ritchie
|
||||
cn: dennis
|
||||
displayName: Dennis Ritchie
|
||||
description: American computer scientist. He created the C programming language and the Unix operating system and B language with long-time colleague Ken Thompson.
|
||||
mail: dennis@example.org
|
||||
uidNumber: 20004
|
||||
gidNumber: 30000
|
||||
homeDirectory: /home/dennis
|
||||
openCloudUserEnabled: TRUE
|
||||
openCloudUUID: cd88bf9a-dd7f-11ef-a609-7f78deb2345f
|
||||
userPassword:: e1NTSEF9Y2ZMdVlqMTBDUFpLWE44VC9mQ0FzYnFHQmtyZExJeGg=
|
||||
|
||||
dn: uid=admin,ou=users,dc=opencloud,dc=eu
|
||||
objectClass: inetOrgPerson
|
||||
objectClass: organizationalPerson
|
||||
objectClass: openCloudUser
|
||||
objectClass: person
|
||||
objectClass: posixAccount
|
||||
objectClass: top
|
||||
uid: admin
|
||||
givenName: Admin
|
||||
sn: Admin
|
||||
cn: admin
|
||||
displayName: Admin
|
||||
description: An admin for this OpenCloud instance.
|
||||
mail: admin@example.org
|
||||
uidNumber: 20005
|
||||
gidNumber: 30000
|
||||
homeDirectory: /home/admin
|
||||
openCloudUserEnabled: TRUE
|
||||
openCloudUUID: f7fc96f6-ceb4-4387-bd69-07a6d7992973
|
||||
userPassword:: e1NTSEF9UWhmaFB3dERydTUydURoWFFObDRMbzVIckI3TkI5Nmo==
|
||||
@@ -0,0 +1,88 @@
|
||||
dn: cn=users,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: users
|
||||
description: Users
|
||||
openCloudUUID: 509a9dcd-bb37-4f4f-a01a-19dca27d9cfa
|
||||
member: uid=alan,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=mary,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=margaret,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=dennis,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=lynn,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=admin,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=chess-lovers,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: chess-lovers
|
||||
description: Chess lovers
|
||||
openCloudUUID: 9d31ec04-dd80-11ef-ac47-a38ba68cc36d
|
||||
member: uid=alan,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=machine-lovers,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: machine-lovers
|
||||
description: Machine Lovers
|
||||
openCloudUUID: d901562a-dd80-11ef-a510-fba1ed43fb21
|
||||
member: uid=alan,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=bible-readers,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: bible-readers
|
||||
description: Bible readers
|
||||
openCloudUUID: 2fc6ba22-dd81-11ef-89e6-e3eff494a998
|
||||
member: uid=mary,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=apollos,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: apollos
|
||||
description: Contributors to the Appollo mission
|
||||
openCloudUUID: 6f9bab36-dd94-11ef-a252-dbbdd20299dd
|
||||
member: uid=margaret,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=unix-lovers,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: unix-lovers
|
||||
description: Unix lovers
|
||||
openCloudUUID: 75bc3882-dd94-11ef-ad60-335f3df6cef3
|
||||
member: uid=dennis,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=basic-haters,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: basic-haters
|
||||
description: Haters of the Basic programming language
|
||||
openCloudUUID: a4eb2c12-dd94-11ef-9ebe-eb96f938d517
|
||||
member: uid=dennis,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=vlsi-lovers,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: vlsi-lovers
|
||||
description: Lovers of VLSI microchip design
|
||||
openCloudUUID: 914ce3de-e899-11ef-9a4b-732fbb2acc42
|
||||
member: uid=lynn,ou=users,dc=opencloud,dc=eu
|
||||
|
||||
dn: cn=programmers,ou=groups,dc=opencloud,dc=eu
|
||||
objectClass: groupOfNames
|
||||
objectClass: openCloudObject
|
||||
objectClass: top
|
||||
cn: programmers
|
||||
description: Computer Programmers
|
||||
openCloudUUID: ce4aa240-dd94-11ef-82b8-4f4828849072
|
||||
member: uid=alan,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=margaret,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=dennis,ou=users,dc=opencloud,dc=eu
|
||||
member: uid=lynn,ou=users,dc=opencloud,dc=eu
|
||||
@@ -7,6 +7,7 @@ directives:
|
||||
- 'https://${COMPANION_DOMAIN|companion.opencloud.test}/'
|
||||
- 'wss://${COMPANION_DOMAIN|companion.opencloud.test}/'
|
||||
- 'https://raw.githubusercontent.com/opencloud-eu/awesome-apps/'
|
||||
- 'https://${KEYCLOAK_DOMAIN|keycloak.opencloud.test}/'
|
||||
default-src:
|
||||
- '''none'''
|
||||
font-src:
|
||||
|
||||
@@ -0,0 +1,77 @@
|
||||
---
|
||||
services:
|
||||
traefik:
|
||||
networks:
|
||||
opencloud-net:
|
||||
aliases:
|
||||
- ${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}
|
||||
|
||||
opencloud:
|
||||
environment:
|
||||
# Keycloak IDP specific configuration
|
||||
PROXY_AUTOPROVISION_ACCOUNTS: "true"
|
||||
PROXY_ROLE_ASSIGNMENT_DRIVER: "oidc"
|
||||
OC_OIDC_ISSUER: https://${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}/realms/${KEYCLOAK_REALM:-openCloud}
|
||||
PROXY_OIDC_REWRITE_WELLKNOWN: "true"
|
||||
WEB_OIDC_CLIENT_ID: ${OC_OIDC_CLIENT_ID:-web}
|
||||
|
||||
PROXY_USER_OIDC_CLAIM: "preferred_username"
|
||||
PROXY_USER_CS3_CLAIM: "username"
|
||||
OC_EXCLUDE_RUN_SERVICES: "idp"
|
||||
|
||||
# admin and demo accounts must be created in Keycloak
|
||||
OC_ADMIN_USER_ID: ""
|
||||
SETTINGS_SETUP_DEFAULT_ASSIGNMENTS: "false"
|
||||
|
||||
GRAPH_ASSIGN_DEFAULT_USER_ROLE: "false"
|
||||
GRAPH_USERNAME_MATCH: "none"
|
||||
KEYCLOAK_DOMAIN: ${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}
|
||||
|
||||
postgres:
|
||||
image: postgres:alpine
|
||||
networks:
|
||||
opencloud-net:
|
||||
volumes:
|
||||
- keycloak_postgres_data:/var/lib/postgresql/data
|
||||
environment:
|
||||
POSTGRES_DB: keycloak
|
||||
POSTGRES_USER: keycloak
|
||||
POSTGRES_PASSWORD: keycloak
|
||||
logging:
|
||||
driver: ${LOG_DRIVER:-local}
|
||||
restart: always
|
||||
|
||||
keycloak:
|
||||
image: quay.io/keycloak/keycloak:25.0.0
|
||||
networks:
|
||||
opencloud-net:
|
||||
command: ["start", "--proxy=edge", "--spi-connections-http-client-default-disable-trust-manager=${INSECURE:-false}", "--import-realm"]
|
||||
entrypoint: ["/bin/sh", "/opt/keycloak/bin/docker-entrypoint-override.sh"]
|
||||
volumes:
|
||||
- "./config/keycloak/docker-entrypoint-override.sh:/opt/keycloak/bin/docker-entrypoint-override.sh"
|
||||
- "./config/keycloak/opencloud-realm.dist.json:/opt/keycloak/data/import-dist/opencloud-realm.json"
|
||||
environment:
|
||||
OC_DOMAIN: ${OC_DOMAIN:-cloud.opencloud.test}
|
||||
KC_HOSTNAME: ${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}
|
||||
KC_DB: postgres
|
||||
KC_DB_URL: "jdbc:postgresql://postgres:5432/keycloak"
|
||||
KC_DB_USERNAME: keycloak
|
||||
KC_DB_PASSWORD: keycloak
|
||||
KC_FEATURES: impersonation
|
||||
KEYCLOAK_ADMIN: ${KEYCLOAK_ADMIN_USER:-admin}
|
||||
KEYCLOAK_ADMIN_PASSWORD: ${KEYCLOAK_ADMIN_PASSWORD:-admin}
|
||||
labels:
|
||||
- "traefik.enable=true"
|
||||
- "traefik.http.routers.keycloak.entrypoints=https"
|
||||
- "traefik.http.routers.keycloak.rule=Host(`${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}`)"
|
||||
- "traefik.http.routers.keycloak.tls.certresolver=http"
|
||||
- "traefik.http.routers.keycloak.service=keycloak"
|
||||
- "traefik.http.services.keycloak.loadbalancer.server.port=8080"
|
||||
depends_on:
|
||||
- postgres
|
||||
logging:
|
||||
driver: ${LOG_DRIVER:-local}
|
||||
restart: always
|
||||
|
||||
volumes:
|
||||
keycloak_postgres_data:
|
||||
@@ -0,0 +1,62 @@
|
||||
---
|
||||
services:
|
||||
traefik:
|
||||
networks:
|
||||
opencloud-net:
|
||||
|
||||
opencloud:
|
||||
environment:
|
||||
# Ldap IDP specific configuration
|
||||
OC_LDAP_URI: ldaps://ldap-server:1636
|
||||
OC_LDAP_INSECURE: "true"
|
||||
OC_LDAP_BIND_DN: "cn=admin,dc=opencloud,dc=eu"
|
||||
OC_LDAP_BIND_PASSWORD: ${LDAP_ADMIN_PASSWORD:-admin}
|
||||
OC_LDAP_GROUP_BASE_DN: "ou=groups,dc=opencloud,dc=eu"
|
||||
OC_LDAP_GROUP_FILTER: "(objectclass=opencloudobject)"
|
||||
OC_LDAP_GROUP_OBJECTCLASS: "groupOfNames"
|
||||
OC_LDAP_USER_BASE_DN: "ou=users,dc=opencloud,dc=eu"
|
||||
OC_LDAP_USER_FILTER: "(objectclass=openclouduser)"
|
||||
OC_LDAP_USER_OBJECTCLASS: "inetOrgPerson"
|
||||
LDAP_LOGIN_ATTRIBUTES: "uid"
|
||||
OC_ADMIN_USER_ID: "f7fc96f6-ceb4-4387-bd69-07a6d7992973"
|
||||
IDP_LDAP_LOGIN_ATTRIBUTE: "uid"
|
||||
IDP_LDAP_UUID_ATTRIBUTE: "openclouduuid"
|
||||
IDP_LDAP_UUID_ATTRIBUTE_TYPE: binary
|
||||
GRAPH_LDAP_SERVER_WRITE_ENABLED: "true" # assuming the external ldap is writable
|
||||
GRAPH_LDAP_REFINT_ENABLED: "true" # osixia has refint enabled.
|
||||
# OC_RUN_SERVICES specifies to start all services except glauth, idm and accounts. These are replaced by external services
|
||||
OC_EXCLUDE_RUN_SERVICES: idm
|
||||
|
||||
ldap-server:
|
||||
image: bitnami/openldap:2.6
|
||||
networks:
|
||||
opencloud-net:
|
||||
entrypoint: ["/bin/sh", "/opt/bitnami/scripts/openldap/docker-entrypoint-override.sh", "/opt/bitnami/scripts/openldap/run.sh" ]
|
||||
environment:
|
||||
BITNAMI_DEBUG: true
|
||||
LDAP_TLS_VERIFY_CLIENT: never
|
||||
LDAP_ENABLE_TLS: "yes"
|
||||
LDAP_TLS_CA_FILE: /opt/bitnami/openldap/share/openldap.crt
|
||||
LDAP_TLS_CERT_FILE: /opt/bitnami/openldap/share/openldap.crt
|
||||
LDAP_TLS_KEY_FILE: /opt/bitnami/openldap/share/openldap.key
|
||||
LDAP_ROOT: "dc=opencloud,dc=eu"
|
||||
LDAP_ADMIN_PASSWORD: ${LDAP_ADMIN_PASSWORD:-admin}
|
||||
ports:
|
||||
- "127.0.0.1:389:1389"
|
||||
- "127.0.0.1:636:1636"
|
||||
volumes:
|
||||
- ./config/ldap/ldif:/ldifs
|
||||
- ../shared/config/ldap/schemas/10_opencloud_schema.ldif:/schemas/10_opencloud_schema.ldif
|
||||
- ./config/ldap/docker-entrypoint-override.sh:/opt/bitnami/scripts/openldap/docker-entrypoint-override.sh
|
||||
- ldap-certs:/opt/bitnami/openldap/share
|
||||
- ldap-data:/bitnami/openldap
|
||||
logging:
|
||||
driver: ${LOG_DRIVER:-local}
|
||||
restart: always
|
||||
|
||||
volumes:
|
||||
ldap-certs:
|
||||
ldap-data:
|
||||
|
||||
networks:
|
||||
opencloud-net:
|
||||
@@ -41,7 +41,11 @@ services:
|
||||
NOTIFICATIONS_SMTP_PORT: "${SMTP_PORT}"
|
||||
NOTIFICATIONS_SMTP_SENDER: "${SMTP_SENDER:-OpenCloud notifications <notifications@${OC_DOMAIN:-cloud.opencloud.test}>}"
|
||||
NOTIFICATIONS_SMTP_USERNAME: "${SMTP_USERNAME}"
|
||||
NOTIFICATIONS_SMTP_PASSWORD: "${SMTP_PASSWORD}"
|
||||
NOTIFICATIONS_SMTP_INSECURE: "${SMTP_INSECURE}"
|
||||
NOTIFICATIONS_SMTP_AUTHENTICATION: "${SMTP_AUTHENTICATION}"
|
||||
NOTIFICATIONS_SMTP_ENCRYPTION: "${SMTP_TRANSPORT_ENCRYPTION:-none}"
|
||||
FRONTEND_ARCHIVER_MAX_SIZE: "10000000000"
|
||||
# make the registry available to the app provider containers
|
||||
MICRO_REGISTRY_ADDRESS: 127.0.0.1:9233
|
||||
NATS_NATS_HOST: 0.0.0.0
|
||||
|
||||
@@ -6,12 +6,10 @@ services:
|
||||
condition: service_completed_successfully
|
||||
|
||||
unzip-init:
|
||||
image: opencloudeu/web-extensions:unzip-1.0.0
|
||||
image: opencloudeu/web-extensions:unzip-1.0.2
|
||||
user: root
|
||||
volumes:
|
||||
- opencloud-apps:/apps
|
||||
entrypoint:
|
||||
- /bin/sh
|
||||
command: ["-c", "cp -R /usr/share/nginx/html/unzip/ /apps"]
|
||||
|
||||
|
||||
@@ -0,0 +1,24 @@
|
||||
---
|
||||
# This file can be used to be added to the opencloud_full example
|
||||
# to browse the LDAP server with a web interface.
|
||||
# This is not a production ready setup.
|
||||
services:
|
||||
ldap-manager:
|
||||
image: phpldapadmin/phpldapadmin:latest
|
||||
networks:
|
||||
opencloud-net:
|
||||
environment:
|
||||
LDAP_HOST: ldap-server
|
||||
LDAP_PORT: 1389
|
||||
LDAP_LOGIN_OBJECTCLASS: "inetOrgPerson"
|
||||
APP_URL: "https://${LDAP_MANAGER_DOMAIN:-ldap.opencloud.test}"
|
||||
labels:
|
||||
- "traefik.enable=true"
|
||||
- "traefik.http.routers.ldap-manager.entrypoints=https"
|
||||
- "traefik.http.routers.ldap-manager.rule=Host(`${LDAP_MANAGER_DOMAIN:-ldap.opencloud.test}`)"
|
||||
- "traefik.http.routers.ldap-manager.tls.certresolver=http"
|
||||
- "traefik.http.routers.ldap-manager.service=ldap-manager"
|
||||
- "traefik.http.services.ldap-manager.loadbalancer.server.port=8080"
|
||||
logging:
|
||||
driver: ${LOG_DRIVER:-local}
|
||||
restart: always
|
||||
@@ -1,17 +0,0 @@
|
||||
---
|
||||
sidebar_position: 1
|
||||
id: intro
|
||||
title: OpenCloud Developer Docs
|
||||
custom_edit_url: https://github.com/opencloud-eu/opencloud/edit/main/docs/intro.md
|
||||
---
|
||||
|
||||
# Welcome
|
||||
|
||||
Welcome to the OpenCloud Developer Documentation.
|
||||
|
||||
Please be patient, we are working on the content.
|
||||
|
||||
If you want to contribute to the dev docs, please visit [OpenCloud on Github](https://github.com/opencloud-eu/).
|
||||
|
||||
Contents will be transferred, during the build process.
|
||||
|
||||
@@ -13,7 +13,7 @@ require (
|
||||
github.com/beevik/etree v1.5.0
|
||||
github.com/blevesearch/bleve/v2 v2.4.4
|
||||
github.com/cenkalti/backoff v2.2.1+incompatible
|
||||
github.com/coreos/go-oidc/v3 v3.13.0
|
||||
github.com/coreos/go-oidc/v3 v3.14.1
|
||||
github.com/cs3org/go-cs3apis v0.0.0-20241105092511-3ad35d174fc1
|
||||
github.com/davidbyttow/govips/v2 v2.16.0
|
||||
github.com/dhowden/tag v0.0.0-20240417053706-3d75831295e8
|
||||
@@ -33,7 +33,7 @@ require (
|
||||
github.com/go-micro/plugins/v4/store/nats-js-kv v0.0.0-20240726082623-6831adfdcdc4
|
||||
github.com/go-micro/plugins/v4/wrapper/monitoring/prometheus v1.2.0
|
||||
github.com/go-micro/plugins/v4/wrapper/trace/opentelemetry v1.2.0
|
||||
github.com/go-playground/validator/v10 v10.25.0
|
||||
github.com/go-playground/validator/v10 v10.26.0
|
||||
github.com/gofrs/uuid v4.4.0+incompatible
|
||||
github.com/golang-jwt/jwt/v5 v5.2.2
|
||||
github.com/golang/protobuf v1.5.4
|
||||
@@ -55,15 +55,15 @@ require (
|
||||
github.com/mitchellh/mapstructure v1.5.0
|
||||
github.com/mna/pigeon v1.3.0
|
||||
github.com/mohae/deepcopy v0.0.0-20170929034955-c48cc78d4826
|
||||
github.com/nats-io/nats-server/v2 v2.11.1
|
||||
github.com/nats-io/nats-server/v2 v2.11.0
|
||||
github.com/nats-io/nats.go v1.41.0
|
||||
github.com/oklog/run v1.1.0
|
||||
github.com/olekukonko/tablewriter v0.0.5
|
||||
github.com/onsi/ginkgo v1.16.5
|
||||
github.com/onsi/ginkgo/v2 v2.23.3
|
||||
github.com/onsi/gomega v1.36.3
|
||||
github.com/open-policy-agent/opa v1.2.0
|
||||
github.com/opencloud-eu/reva/v2 v2.29.4
|
||||
github.com/onsi/ginkgo/v2 v2.23.4
|
||||
github.com/onsi/gomega v1.37.0
|
||||
github.com/open-policy-agent/opa v1.3.0
|
||||
github.com/opencloud-eu/reva/v2 v2.31.0
|
||||
github.com/orcaman/concurrent-map v1.0.0
|
||||
github.com/owncloud/libre-graph-api-go v1.0.5-0.20240829135935-80dc00d6f5ea
|
||||
github.com/pkg/errors v0.9.1
|
||||
@@ -82,9 +82,9 @@ require (
|
||||
github.com/test-go/testify v1.1.4
|
||||
github.com/thejerf/suture/v4 v4.0.6
|
||||
github.com/tidwall/gjson v1.18.0
|
||||
github.com/tus/tusd/v2 v2.7.1
|
||||
github.com/tus/tusd/v2 v2.8.0
|
||||
github.com/unrolled/secure v1.16.0
|
||||
github.com/urfave/cli/v2 v2.27.5
|
||||
github.com/urfave/cli/v2 v2.27.6
|
||||
github.com/xhit/go-simple-mail/v2 v2.16.0
|
||||
go-micro.dev/v4 v4.11.0
|
||||
go.etcd.io/bbolt v1.4.0
|
||||
@@ -99,14 +99,14 @@ require (
|
||||
golang.org/x/crypto v0.36.0
|
||||
golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac
|
||||
golang.org/x/image v0.25.0
|
||||
golang.org/x/net v0.37.0
|
||||
golang.org/x/net v0.38.0
|
||||
golang.org/x/oauth2 v0.28.0
|
||||
golang.org/x/sync v0.12.0
|
||||
golang.org/x/term v0.30.0
|
||||
golang.org/x/text v0.23.0
|
||||
google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb
|
||||
google.golang.org/grpc v1.71.0
|
||||
google.golang.org/protobuf v1.36.5
|
||||
google.golang.org/grpc v1.71.1
|
||||
google.golang.org/protobuf v1.36.6
|
||||
gopkg.in/yaml.v2 v2.4.0
|
||||
gotest.tools/v3 v3.5.2
|
||||
stash.kopano.io/kgol/rndm v1.1.2
|
||||
@@ -216,7 +216,7 @@ require (
|
||||
github.com/gomodule/redigo v1.9.2 // indirect
|
||||
github.com/google/go-querystring v1.1.0 // indirect
|
||||
github.com/google/go-tpm v0.9.3 // indirect
|
||||
github.com/google/pprof v0.0.0-20241210010833-40e02aabc2ad // indirect
|
||||
github.com/google/pprof v0.0.0-20250403155104-27863c87afa6 // indirect
|
||||
github.com/google/renameio/v2 v2.0.0 // indirect
|
||||
github.com/gookit/color v1.5.4 // indirect
|
||||
github.com/gookit/goutil v0.6.15 // indirect
|
||||
@@ -237,7 +237,7 @@ require (
|
||||
github.com/juliangruber/go-intersect v1.1.0 // indirect
|
||||
github.com/kevinburke/ssh_config v1.2.0 // indirect
|
||||
github.com/klauspost/compress v1.18.0 // indirect
|
||||
github.com/klauspost/cpuid/v2 v2.2.9 // indirect
|
||||
github.com/klauspost/cpuid/v2 v2.2.10 // indirect
|
||||
github.com/leodido/go-urn v1.4.0 // indirect
|
||||
github.com/libregraph/oidc-go v1.1.0 // indirect
|
||||
github.com/longsleep/go-metrics v1.0.0 // indirect
|
||||
@@ -246,7 +246,7 @@ require (
|
||||
github.com/mattn/go-colorable v0.1.14 // indirect
|
||||
github.com/mattn/go-isatty v0.0.20 // indirect
|
||||
github.com/mattn/go-runewidth v0.0.16 // indirect
|
||||
github.com/mattn/go-sqlite3 v1.14.24 // indirect
|
||||
github.com/mattn/go-sqlite3 v1.14.27 // indirect
|
||||
github.com/maxymania/go-system v0.0.0-20170110133659-647cc364bf0b // indirect
|
||||
github.com/mendsley/gojwk v0.0.0-20141217222730-4d5ec6e58103 // indirect
|
||||
github.com/miekg/dns v1.1.57 // indirect
|
||||
@@ -254,7 +254,7 @@ require (
|
||||
github.com/minio/crc64nvme v1.0.1 // indirect
|
||||
github.com/minio/highwayhash v1.0.3 // indirect
|
||||
github.com/minio/md5-simd v1.1.2 // indirect
|
||||
github.com/minio/minio-go/v7 v7.0.88 // indirect
|
||||
github.com/minio/minio-go/v7 v7.0.89 // indirect
|
||||
github.com/mitchellh/copystructure v1.2.0 // indirect
|
||||
github.com/mitchellh/reflectwalk v1.0.2 // indirect
|
||||
github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect
|
||||
@@ -318,14 +318,15 @@ require (
|
||||
go.opentelemetry.io/otel/metric v1.35.0 // indirect
|
||||
go.opentelemetry.io/proto/otlp v1.5.0 // indirect
|
||||
go.uber.org/atomic v1.11.0 // indirect
|
||||
go.uber.org/automaxprocs v1.6.0 // indirect
|
||||
go.uber.org/multierr v1.11.0 // indirect
|
||||
go.uber.org/zap v1.23.0 // indirect
|
||||
golang.org/x/mod v0.24.0 // indirect
|
||||
golang.org/x/sys v0.31.0 // indirect
|
||||
golang.org/x/sys v0.32.0 // indirect
|
||||
golang.org/x/time v0.11.0 // indirect
|
||||
golang.org/x/tools v0.31.0 // indirect
|
||||
golang.org/x/xerrors v0.0.0-20220907171357-04be3eba64a2 // indirect
|
||||
google.golang.org/genproto v0.0.0-20241118233622-e639e219e697 // indirect
|
||||
google.golang.org/genproto v0.0.0-20250303144028-a0af3efb3deb // indirect
|
||||
google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb // indirect
|
||||
gopkg.in/cenkalti/backoff.v1 v1.1.0 // indirect
|
||||
gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 // indirect
|
||||
|
||||
@@ -222,8 +222,8 @@ github.com/cloudflare/cloudflare-go v0.14.0/go.mod h1:EnwdgGMaFOruiPZRFSgn+TsQ3h
|
||||
github.com/cncf/udpa/go v0.0.0-20191209042840-269d4d468f6f/go.mod h1:M8M6+tZqaGXZJjfX53e64911xZQV5JYwmTeXPW+k8Sc=
|
||||
github.com/coreos/bbolt v1.3.2/go.mod h1:iRUV2dpdMOn7Bo10OQBFzIJO9kkE559Wcmn+qkEiiKk=
|
||||
github.com/coreos/etcd v3.3.13+incompatible/go.mod h1:uF7uidLiAD3TWHmW31ZFd/JWoc32PjwdhPthX9715RE=
|
||||
github.com/coreos/go-oidc/v3 v3.13.0 h1:M66zd0pcc5VxvBNM4pB331Wrsanby+QomQYjN8HamW8=
|
||||
github.com/coreos/go-oidc/v3 v3.13.0/go.mod h1:HaZ3szPaZ0e4r6ebqvsLWlk2Tn+aejfmrfah6hnSYEU=
|
||||
github.com/coreos/go-oidc/v3 v3.14.1 h1:9ePWwfdwC4QKRlCXsJGou56adA/owXczOzwKdOumLqk=
|
||||
github.com/coreos/go-oidc/v3 v3.14.1/go.mod h1:HaZ3szPaZ0e4r6ebqvsLWlk2Tn+aejfmrfah6hnSYEU=
|
||||
github.com/coreos/go-semver v0.3.0 h1:wkHLiw0WNATZnSG7epLsujiMCgPAc9xhjJ4tgnAxmfM=
|
||||
github.com/coreos/go-semver v0.3.0/go.mod h1:nnelYz7RCh+5ahJtPPxZlU+153eP4D4r3EedlOD2RNk=
|
||||
github.com/coreos/go-systemd v0.0.0-20190321100706-95778dfbb74e/go.mod h1:F5haX7vjVVG0kc13fIWeqUViNPyEJxv/OmvnBo0Yme4=
|
||||
@@ -258,8 +258,8 @@ github.com/deckarep/golang-set v1.8.0/go.mod h1:5nI87KwE7wgsBU1F4GKAw2Qod7p5kyS3
|
||||
github.com/deepmap/oapi-codegen v1.3.11/go.mod h1:suMvK7+rKlx3+tpa8ByptmvoXbAV70wERKTOGH3hLp0=
|
||||
github.com/desertbit/timer v0.0.0-20180107155436-c41aec40b27f h1:U5y3Y5UE0w7amNe7Z5G/twsBW0KEalRQXZzf8ufSh9I=
|
||||
github.com/desertbit/timer v0.0.0-20180107155436-c41aec40b27f/go.mod h1:xH/i4TFMt8koVQZ6WFms69WAsDWr2XsYL3Hkl7jkoLE=
|
||||
github.com/dgraph-io/badger/v4 v4.5.1 h1:7DCIXrQjo1LKmM96YD+hLVJ2EEsyyoWxJfpdd56HLps=
|
||||
github.com/dgraph-io/badger/v4 v4.5.1/go.mod h1:qn3Be0j3TfV4kPbVoK0arXCD1/nr1ftth6sbL5jxdoA=
|
||||
github.com/dgraph-io/badger/v4 v4.6.0 h1:acOwfOOZ4p1dPRnYzvkVm7rUk2Y21TgPVepCy5dJdFQ=
|
||||
github.com/dgraph-io/badger/v4 v4.6.0/go.mod h1:KSJ5VTuZNC3Sd+YhvVjk2nYua9UZnnTr/SkXvdtiPgI=
|
||||
github.com/dgraph-io/ristretto v0.2.0 h1:XAfl+7cmoUDWW/2Lx8TGZQjjxIQ2Ley9DSf52dru4WE=
|
||||
github.com/dgraph-io/ristretto v0.2.0/go.mod h1:8uBHCU/PBV4Ag0CJrP47b9Ofby5dqWNh4FicAdoqFNU=
|
||||
github.com/dgraph-io/ristretto/v2 v2.1.0 h1:59LjpOJLNDULHh8MC4UaegN52lC4JnO2dITsie/Pa8I=
|
||||
@@ -411,8 +411,8 @@ github.com/go-playground/locales v0.14.1 h1:EWaQ/wswjilfKLTECiXz7Rh+3BjFhfDFKv/o
|
||||
github.com/go-playground/locales v0.14.1/go.mod h1:hxrqLVvrK65+Rwrd5Fc6F2O76J/NuW9t0sjnWqG1slY=
|
||||
github.com/go-playground/universal-translator v0.18.1 h1:Bcnm0ZwsGyWbCzImXv+pAJnYK9S473LQFuzCbDbfSFY=
|
||||
github.com/go-playground/universal-translator v0.18.1/go.mod h1:xekY+UJKNuX9WP91TpwSH2VMlDf28Uj24BCp08ZFTUY=
|
||||
github.com/go-playground/validator/v10 v10.25.0 h1:5Dh7cjvzR7BRZadnsVOzPhWsrwUr0nmsZJxEAnFLNO8=
|
||||
github.com/go-playground/validator/v10 v10.25.0/go.mod h1:GGzBIJMuE98Ic/kJsBXbz1x/7cByt++cQ+YOuDM5wus=
|
||||
github.com/go-playground/validator/v10 v10.26.0 h1:SP05Nqhjcvz81uJaRfEV0YBSSSGMc/iMaVtFbr3Sw2k=
|
||||
github.com/go-playground/validator/v10 v10.26.0/go.mod h1:I5QpIEbmr8On7W0TktmJAumgzX4CA1XNl4ZmDuVHKKo=
|
||||
github.com/go-redis/redis/v8 v8.11.5 h1:AcZZR7igkdvfVmQTPnu9WE37LRrO/YrBH5zWyjDC0oI=
|
||||
github.com/go-redis/redis/v8 v8.11.5/go.mod h1:gREzHqY1hg6oD9ngVRbLStwAWKhA0FEgq8Jd4h5lpwo=
|
||||
github.com/go-resty/resty/v2 v2.1.1-0.20191201195748-d7b97669fe48/go.mod h1:dZGr0i9PLlaaTD4H/hoZIDjQ+r6xq8mgbRzHZf7f2J8=
|
||||
@@ -504,8 +504,8 @@ github.com/gomodule/redigo v1.9.2 h1:HrutZBLhSIU8abiSfW8pj8mPhOyMYjZT/wcA4/L9L9s
|
||||
github.com/gomodule/redigo v1.9.2/go.mod h1:KsU3hiK/Ay8U42qpaJk+kuNa3C+spxapWpM+ywhcgtw=
|
||||
github.com/google/btree v0.0.0-20180813153112-4030bb1f1f0c/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ=
|
||||
github.com/google/btree v1.0.0/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ=
|
||||
github.com/google/flatbuffers v24.12.23+incompatible h1:ubBKR94NR4pXUCY/MUsRVzd9umNW7ht7EG9hHfS9FX8=
|
||||
github.com/google/flatbuffers v24.12.23+incompatible/go.mod h1:1AeVuKshWv4vARoZatz6mlQ0JxURH0Kv5+zNeJKJCa8=
|
||||
github.com/google/flatbuffers v25.2.10+incompatible h1:F3vclr7C3HpB1k9mxCGRMXq6FdUalZ6H/pNX4FP1v0Q=
|
||||
github.com/google/flatbuffers v25.2.10+incompatible/go.mod h1:1AeVuKshWv4vARoZatz6mlQ0JxURH0Kv5+zNeJKJCa8=
|
||||
github.com/google/go-cmp v0.2.0/go.mod h1:oXzfMopK8JAjlY9xF4vHSVASa0yLyX7SntLO5aqRK0M=
|
||||
github.com/google/go-cmp v0.3.0/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU=
|
||||
github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU=
|
||||
@@ -540,8 +540,8 @@ github.com/google/pprof v0.0.0-20200212024743-f11f1df84d12/go.mod h1:ZgVRPoUq/hf
|
||||
github.com/google/pprof v0.0.0-20200229191704-1ebb73c60ed3/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
|
||||
github.com/google/pprof v0.0.0-20200430221834-fc25d7d30c6d/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
|
||||
github.com/google/pprof v0.0.0-20200708004538-1a94d8640e99/go.mod h1:ZgVRPoUq/hfqzAqh7sHMqb3I9Rq5C59dIz2SbBwJ4eM=
|
||||
github.com/google/pprof v0.0.0-20241210010833-40e02aabc2ad h1:a6HEuzUHeKH6hwfN/ZoQgRgVIWFJljSWa/zetS2WTvg=
|
||||
github.com/google/pprof v0.0.0-20241210010833-40e02aabc2ad/go.mod h1:vavhavw2zAxS5dIdcRluK6cSGGPlZynqzFM8NdvU144=
|
||||
github.com/google/pprof v0.0.0-20250403155104-27863c87afa6 h1:BHT72Gu3keYf3ZEu2J0b1vyeLSOYI8bm5wbJM/8yDe8=
|
||||
github.com/google/pprof v0.0.0-20250403155104-27863c87afa6/go.mod h1:boTsfXsheKC2y+lKOCMpSfarhxDeIzfZG1jqGcPl3cA=
|
||||
github.com/google/renameio v0.1.0/go.mod h1:KWCgfxg9yswjAJkECMjeO8J8rahYeXnNhOm40UhjYkI=
|
||||
github.com/google/renameio/v2 v2.0.0 h1:UifI23ZTGY8Tt29JbYFiuyIU3eX+RNFtUwefq9qAhxg=
|
||||
github.com/google/renameio/v2 v2.0.0/go.mod h1:BtmJXm5YlszgC+TD4HOEEUFgkJP3nLxehU6hfe7jRt4=
|
||||
@@ -689,8 +689,8 @@ github.com/klauspost/compress v1.15.9/go.mod h1:PhcZ0MbTNciWF3rruxRgKxI5NkcHHrHU
|
||||
github.com/klauspost/compress v1.18.0 h1:c/Cqfb0r+Yi+JtIEq73FWXVkRonBlf0CRNYc8Zttxdo=
|
||||
github.com/klauspost/compress v1.18.0/go.mod h1:2Pp+KzxcywXVXMr50+X0Q/Lsb43OQHYWRCY2AiWywWQ=
|
||||
github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
|
||||
github.com/klauspost/cpuid/v2 v2.2.9 h1:66ze0taIn2H33fBvCkXuv9BmCwDfafmiIVpKV9kKGuY=
|
||||
github.com/klauspost/cpuid/v2 v2.2.9/go.mod h1:rqkxqrZ1EhYM9G+hXH7YdowN5R5RGN6NK4QwQ3WMXF8=
|
||||
github.com/klauspost/cpuid/v2 v2.2.10 h1:tBs3QSyvjDyFTq3uoc/9xFpCuOsJQFNPiAhYdw2skhE=
|
||||
github.com/klauspost/cpuid/v2 v2.2.10/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0=
|
||||
github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202 h1:A1xJ2NKgiYFiaHiLl9B5yw/gUBACSs9crDykTS3GuQI=
|
||||
github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202/go.mod h1:bHA7t77X/QFExdeAnDzK6vKM34kEZAcE1OX4MfiwjkE=
|
||||
github.com/kobergj/plugins/v4/store/nats-js-kv v0.0.0-20240807130109-f62bb67e8c90 h1:pfI8Z5yavO6fU6vDGlWhZ4BgDlvj8c6xB7J57HfTPwA=
|
||||
@@ -768,8 +768,8 @@ github.com/mattn/go-runewidth v0.0.6/go.mod h1:H031xJmbD/WCDINGzjvQ9THkh0rPKHF+m
|
||||
github.com/mattn/go-runewidth v0.0.9/go.mod h1:H031xJmbD/WCDINGzjvQ9THkh0rPKHF+m2gUSrubnMI=
|
||||
github.com/mattn/go-runewidth v0.0.16 h1:E5ScNMtiwvlvB5paMFdw9p4kSQzbXFikJ5SQO6TULQc=
|
||||
github.com/mattn/go-runewidth v0.0.16/go.mod h1:Jdepj2loyihRzMpdS35Xk/zdY8IAYHsh153qUoGf23w=
|
||||
github.com/mattn/go-sqlite3 v1.14.24 h1:tpSp2G2KyMnnQu99ngJ47EIkWVmliIizyZBfPrBWDRM=
|
||||
github.com/mattn/go-sqlite3 v1.14.24/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
|
||||
github.com/mattn/go-sqlite3 v1.14.27 h1:drZCnuvf37yPfs95E5jd9s3XhdVWLal+6BOK6qrv6IU=
|
||||
github.com/mattn/go-sqlite3 v1.14.27/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
|
||||
github.com/mattn/go-tty v0.0.0-20180219170247-931426f7535a/go.mod h1:XPvLUNfbS4fJH25nqRHfWLMa1ONC8Amw+mIA639KxkE=
|
||||
github.com/mattn/go-tty v0.0.3/go.mod h1:ihxohKRERHTVzN+aSVRwACLCeqIoZAWpoICkkvrWyR0=
|
||||
github.com/matttproud/golang_protobuf_extensions v1.0.1/go.mod h1:D8He9yQNgCq6Z5Ld7szi9bcBfOoFv/3dc6xSMkL2PC0=
|
||||
@@ -789,8 +789,8 @@ github.com/minio/highwayhash v1.0.3 h1:kbnuUMoHYyVl7szWjSxJnxw11k2U709jqFPPmIUyD
|
||||
github.com/minio/highwayhash v1.0.3/go.mod h1:GGYsuwP/fPD6Y9hMiXuapVvlIUEhFhMTh0rxU3ik1LQ=
|
||||
github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34=
|
||||
github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM=
|
||||
github.com/minio/minio-go/v7 v7.0.88 h1:v8MoIJjwYxOkehp+eiLIuvXk87P2raUtoU5klrAAshs=
|
||||
github.com/minio/minio-go/v7 v7.0.88/go.mod h1:33+O8h0tO7pCeCWwBVa07RhVVfB/3vS4kEX7rwYKmIg=
|
||||
github.com/minio/minio-go/v7 v7.0.89 h1:hx4xV5wwTUfyv8LarhJAwNecnXpoTsj9v3f3q/ZkiJU=
|
||||
github.com/minio/minio-go/v7 v7.0.89/go.mod h1:2rFnGAp02p7Dddo1Fq4S2wYOfpF0MUTSeLTRC90I204=
|
||||
github.com/mitchellh/cli v1.0.0/go.mod h1:hNIlj7HEI86fIcpObd7a0FcrxTWetlwJDGcceTlRvqc=
|
||||
github.com/mitchellh/copystructure v1.2.0 h1:vpKXTN4ewci03Vljg/q9QvCGUDttBOGBIa15WveJJGw=
|
||||
github.com/mitchellh/copystructure v1.2.0/go.mod h1:qLl+cE2AmVv+CoeAwDPye/v+N2HKCj9FbZEVFJRxO9s=
|
||||
@@ -827,8 +827,8 @@ github.com/mwitkow/go-conntrack v0.0.0-20190716064945-2f068394615f/go.mod h1:qRW
|
||||
github.com/namedotcom/go v0.0.0-20180403034216-08470befbe04/go.mod h1:5sN+Lt1CaY4wsPvgQH/jsuJi4XO2ssZbdsIizr4CVC8=
|
||||
github.com/nats-io/jwt/v2 v2.7.3 h1:6bNPK+FXgBeAqdj4cYQ0F8ViHRbi7woQLq4W29nUAzE=
|
||||
github.com/nats-io/jwt/v2 v2.7.3/go.mod h1:GvkcbHhKquj3pkioy5put1wvPxs78UlZ7D/pY+BgZk4=
|
||||
github.com/nats-io/nats-server/v2 v2.11.1 h1:LwdauqMqMNhTxTN3+WFTX6wGDOKntHljgZ+7gL5HCnk=
|
||||
github.com/nats-io/nats-server/v2 v2.11.1/go.mod h1:leXySghbdtXSUmWem8K9McnJ6xbJOb0t9+NQ5HTRZjI=
|
||||
github.com/nats-io/nats-server/v2 v2.11.0 h1:fdwAT1d6DZW/4LUz5rkvQUe5leGEwjjOQYntzVRKvjE=
|
||||
github.com/nats-io/nats-server/v2 v2.11.0/go.mod h1:leXySghbdtXSUmWem8K9McnJ6xbJOb0t9+NQ5HTRZjI=
|
||||
github.com/nats-io/nats.go v1.41.0 h1:PzxEva7fflkd+n87OtQTXqCTyLfIIMFJBpyccHLE2Ko=
|
||||
github.com/nats-io/nats.go v1.41.0/go.mod h1:wV73x0FSI/orHPSYoyMeJB+KajMDoWyXmFaRrrYaaTo=
|
||||
github.com/nats-io/nkeys v0.4.10 h1:glmRrpCmYLHByYcePvnTBEAwawwapjCPMjy2huw20wc=
|
||||
@@ -856,17 +856,17 @@ github.com/onsi/ginkgo v1.7.0/go.mod h1:lLunBs/Ym6LB5Z9jYTR76FiuTmxDTDusOGeTQH+W
|
||||
github.com/onsi/ginkgo v1.12.1/go.mod h1:zj2OWP4+oCPe1qIXoGWkgMRwljMUYCdkwsT2108oapk=
|
||||
github.com/onsi/ginkgo v1.16.5 h1:8xi0RTUf59SOSfEtZMvwTvXYMzG4gV23XVHOZiXNtnE=
|
||||
github.com/onsi/ginkgo v1.16.5/go.mod h1:+E8gABHa3K6zRBolWtd+ROzc/U5bkGt0FwiG042wbpU=
|
||||
github.com/onsi/ginkgo/v2 v2.23.3 h1:edHxnszytJ4lD9D5Jjc4tiDkPBZ3siDeJJkUZJJVkp0=
|
||||
github.com/onsi/ginkgo/v2 v2.23.3/go.mod h1:zXTP6xIp3U8aVuXN8ENK9IXRaTjFnpVB9mGmaSRvxnM=
|
||||
github.com/onsi/ginkgo/v2 v2.23.4 h1:ktYTpKJAVZnDT4VjxSbiBenUjmlL/5QkBEocaWXiQus=
|
||||
github.com/onsi/ginkgo/v2 v2.23.4/go.mod h1:Bt66ApGPBFzHyR+JO10Zbt0Gsp4uWxu5mIOTusL46e8=
|
||||
github.com/onsi/gomega v1.4.3/go.mod h1:ex+gbHU/CVuBBDIJjb2X0qEXbFg53c61hWP/1CpauHY=
|
||||
github.com/onsi/gomega v1.7.1/go.mod h1:XdKZgCCFLUoM/7CFJVPcG8C1xQ1AJ0vpAezJrB7JYyY=
|
||||
github.com/onsi/gomega v1.10.1/go.mod h1:iN09h71vgCQne3DLsj+A5owkum+a2tYe+TOCB1ybHNo=
|
||||
github.com/onsi/gomega v1.36.3 h1:hID7cr8t3Wp26+cYnfcjR6HpJ00fdogN6dqZ1t6IylU=
|
||||
github.com/onsi/gomega v1.36.3/go.mod h1:8D9+Txp43QWKhM24yyOBEdpkzN8FvJyAwecBgsU4KU0=
|
||||
github.com/open-policy-agent/opa v1.2.0 h1:88NDVCM0of1eO6Z4AFeL3utTEtMuwloFmWWU7dRV1z0=
|
||||
github.com/open-policy-agent/opa v1.2.0/go.mod h1:30euUmOvuBoebRCcJ7DMF42bRBOPznvt0ACUMYDUGVY=
|
||||
github.com/opencloud-eu/reva/v2 v2.29.4 h1:UaykCqG3FNEpaeZzixsJBGi+j/Ihl3qASQ1WgcYTDb0=
|
||||
github.com/opencloud-eu/reva/v2 v2.29.4/go.mod h1:+nkCU7w6E6cyNSsKRYj1rb0cCI7QswEQ7KOPljctebM=
|
||||
github.com/onsi/gomega v1.37.0 h1:CdEG8g0S133B4OswTDC/5XPSzE1OeP29QOioj2PID2Y=
|
||||
github.com/onsi/gomega v1.37.0/go.mod h1:8D9+Txp43QWKhM24yyOBEdpkzN8FvJyAwecBgsU4KU0=
|
||||
github.com/open-policy-agent/opa v1.3.0 h1:zVvQvQg+9+FuSRBt4LgKNzJwsWl/c85kD5jPozJTydY=
|
||||
github.com/open-policy-agent/opa v1.3.0/go.mod h1:t9iPNhaplD2qpiBqeudzJtEX3fKHK8zdA29oFvofAHo=
|
||||
github.com/opencloud-eu/reva/v2 v2.31.0 h1:UVgeb0hSPoaDdqcKSJ7XZAhXCtHaVK9qm/JtFtJM/7U=
|
||||
github.com/opencloud-eu/reva/v2 v2.31.0/go.mod h1:8MT1a/WJASZZhlSMC0oeE3ECQdjqFw3BUiiAIZ/JR8I=
|
||||
github.com/opentracing/opentracing-go v1.1.0/go.mod h1:UkNAQd3GIcIGf0SeVgPpRdFStlNbqXla1AfSYxPUl2o=
|
||||
github.com/opentracing/opentracing-go v1.2.0 h1:uEJPy/1a5RIPAJ0Ov+OIO8OxWu77jEv+1B0VhjKrZUs=
|
||||
github.com/opentracing/opentracing-go v1.2.0/go.mod h1:GxEUsuufX4nBwe+T+Wl9TAgYrxe9dPLANfrWvHYVTgc=
|
||||
@@ -911,6 +911,8 @@ github.com/posener/complete v1.1.1/go.mod h1:em0nMJCgc9GFtwrmVmEMR/ZL6WyhyjMBndr
|
||||
github.com/pquerna/cachecontrol v0.2.0 h1:vBXSNuE5MYP9IJ5kjsdo8uq+w41jSPgvba2DEnkRx9k=
|
||||
github.com/pquerna/cachecontrol v0.2.0/go.mod h1:NrUG3Z7Rdu85UNR3vm7SOsl1nFIeSiQnrHV5K9mBcUI=
|
||||
github.com/pquerna/otp v1.3.0/go.mod h1:dkJfzwRKNiegxyNb54X/3fLwhCynbMspSyWKnvi1AEg=
|
||||
github.com/prashantv/gostub v1.1.0 h1:BTyx3RfQjRHnUWaGF9oQos79AlQ5k8WNktv7VGvVH4g=
|
||||
github.com/prashantv/gostub v1.1.0/go.mod h1:A5zLQHz7ieHGG7is6LLXLz7I8+3LZzsrV0P1IAHhP5U=
|
||||
github.com/prometheus/alertmanager v0.28.1 h1:BK5pCoAtaKg01BYRUJhEDV1tqJMEtYBGzPw8QdvnnvA=
|
||||
github.com/prometheus/alertmanager v0.28.1/go.mod h1:0StpPUDDHi1VXeM7p2yYfeZgLVi/PPlt39vo9LQUHxM=
|
||||
github.com/prometheus/client_golang v0.8.0/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXPKyh/dDVn+NZz0KFw=
|
||||
@@ -1098,13 +1100,13 @@ github.com/toorop/go-dkim v0.0.0-20201103131630-e1cd1a0a5208/go.mod h1:BzWtXXrXz
|
||||
github.com/transip/gotransip/v6 v6.2.0/go.mod h1:pQZ36hWWRahCUXkFWlx9Hs711gLd8J4qdgLdRzmtY+g=
|
||||
github.com/trustelem/zxcvbn v1.0.1 h1:mp4JFtzdDYGj9WYSD3KQSkwwUumWNFzXaAjckaTYpsc=
|
||||
github.com/trustelem/zxcvbn v1.0.1/go.mod h1:zonUyKeh7sw6psPf/e3DtRqkRyZvAbOfjNz/aO7YQ5s=
|
||||
github.com/tus/tusd/v2 v2.7.1 h1:TGJjhv9RYXDmsTz8ug/qSd9vQpmD0Ik0G0IPo80Qmc0=
|
||||
github.com/tus/tusd/v2 v2.7.1/go.mod h1:PLdIMQ/ge+5ADgGKcL3FgTaPs+7wB0JIiI5HQXAiJE8=
|
||||
github.com/tus/tusd/v2 v2.8.0 h1:X2jGxQ05jAW4inDd2ogmOKqwnb4c/D0lw2yhgHayWyU=
|
||||
github.com/tus/tusd/v2 v2.8.0/go.mod h1:3/zEOVQQIwmJhvNam8phV4x/UQt68ZmZiTzeuJUNhVo=
|
||||
github.com/uber-go/atomic v1.3.2/go.mod h1:/Ct5t2lcmbJ4OSe/waGBoaVvVqtO0bmtfVNex1PFV8g=
|
||||
github.com/urfave/cli v1.22.4/go.mod h1:Gos4lmkARVdJ6EkW0WaNv/tZAAMe9V7XWyB60NtXRu0=
|
||||
github.com/urfave/cli/v2 v2.3.0/go.mod h1:LJmUH05zAU44vOAcrfzZQKsZbVcdbOG8rtL3/XcUArI=
|
||||
github.com/urfave/cli/v2 v2.27.5 h1:WoHEJLdsXr6dDWoJgMq/CboDmyY/8HMMH1fTECbih+w=
|
||||
github.com/urfave/cli/v2 v2.27.5/go.mod h1:3Sevf16NykTbInEnD0yKkjDAeZDS0A6bzhBH5hrMvTQ=
|
||||
github.com/urfave/cli/v2 v2.27.6 h1:VdRdS98FNhKZ8/Az8B7MTyGQmpIr36O1EHybx/LaZ4g=
|
||||
github.com/urfave/cli/v2 v2.27.6/go.mod h1:3Sevf16NykTbInEnD0yKkjDAeZDS0A6bzhBH5hrMvTQ=
|
||||
github.com/valyala/bytebufferpool v1.0.0/go.mod h1:6bBcMArwyJ5K/AmCkWv1jt77kVWyCJ6HpOuEn7z0Csc=
|
||||
github.com/valyala/fasttemplate v1.0.1/go.mod h1:UQGH1tvbgY+Nz5t2n7tXsz52dQxojPUpymEIMZ47gx8=
|
||||
github.com/valyala/fasttemplate v1.1.0/go.mod h1:UQGH1tvbgY+Nz5t2n7tXsz52dQxojPUpymEIMZ47gx8=
|
||||
@@ -1177,6 +1179,8 @@ go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.35.0 h1:1fTNlAIJZGWLP5FVu0f
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.35.0/go.mod h1:zjPK58DtkqQFn+YUMbx0M2XV3QgKU0gS9LeGohREyK4=
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.35.0 h1:m639+BofXTvcY1q8CGs4ItwQarYtJPOWmVobfM1HpVI=
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.35.0/go.mod h1:LjReUci/F4BUyv+y4dwnq3h/26iNOeC3wAIqgvTIZVo=
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp v1.35.0 h1:xJ2qHD0C1BeYVTLLR9sX12+Qb95kfeD/byKj6Ky1pXg=
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp v1.35.0/go.mod h1:u5BF1xyjstDowA1R5QAO9JHzqK+ublenEW/dyqTjBVk=
|
||||
go.opentelemetry.io/otel/metric v1.35.0 h1:0znxYu2SNyuMSQT4Y9WDWej0VpcsxkuklLa4/siN90M=
|
||||
go.opentelemetry.io/otel/metric v1.35.0/go.mod h1:nKVFgxBZ2fReX6IlyW28MgZojkoAkJGaE8CpgeAU3oE=
|
||||
go.opentelemetry.io/otel/sdk v1.35.0 h1:iPctf8iprVySXSKJffSS79eOjl9pvxV9ZqOWT0QejKY=
|
||||
@@ -1192,6 +1196,8 @@ go.uber.org/atomic v1.4.0/go.mod h1:gD2HeocX3+yG+ygLZcrzQJaqmWj9AIm7n08wl/qW/PE=
|
||||
go.uber.org/atomic v1.7.0/go.mod h1:fEN4uk6kAWBTFdckzkM89CLk9XfWZrxpCo0nPH17wJc=
|
||||
go.uber.org/atomic v1.11.0 h1:ZvwS0R+56ePWxUNi+Atn9dWONBPp/AUETXlHW0DxSjE=
|
||||
go.uber.org/atomic v1.11.0/go.mod h1:LUxbIzbOniOlMKjJjyPfpl4v+PKK2cNJn91OQbhoJI0=
|
||||
go.uber.org/automaxprocs v1.6.0 h1:O3y2/QNTOdbF+e/dpXNNW7Rx2hZ4sTIPyybbxyNqTUs=
|
||||
go.uber.org/automaxprocs v1.6.0/go.mod h1:ifeIMSnPZuznNm6jmdzmU3/bfk01Fe2fotchwEFJ8r8=
|
||||
go.uber.org/goleak v1.1.10/go.mod h1:8a7PlsEVH3e/a/GLqe5IIrQx6GzcnRmZEufDUTk4A7A=
|
||||
go.uber.org/goleak v1.3.0 h1:2K3zAYmnTNqV73imy9J1T3WC+gmCePx2hEGkimedGto=
|
||||
go.uber.org/goleak v1.3.0/go.mod h1:CoHD4mav9JJNrW/WLlf7HGZPjdw8EucARQHekz1X6bE=
|
||||
@@ -1328,8 +1334,8 @@ golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
|
||||
golang.org/x/net v0.23.0/go.mod h1:JKghWKKOSdJwpW2GEx0Ja7fmaKnMsbu+MWVZTokSYmg=
|
||||
golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
|
||||
golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
|
||||
golang.org/x/net v0.37.0 h1:1zLorHbz+LYj7MQlSf1+2tPIIgibq2eL5xkrGk6f+2c=
|
||||
golang.org/x/net v0.37.0/go.mod h1:ivrbrMbzFq5J41QOQh0siUuly180yBYtLp+CKbEaFx8=
|
||||
golang.org/x/net v0.38.0 h1:vRMAPTMaeGqVhG5QyLJHqNDwecKTomGeqbnfZyKlBI8=
|
||||
golang.org/x/net v0.38.0/go.mod h1:ivrbrMbzFq5J41QOQh0siUuly180yBYtLp+CKbEaFx8=
|
||||
golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U=
|
||||
golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
|
||||
golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
|
||||
@@ -1440,8 +1446,8 @@ golang.org/x/sys v0.18.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
|
||||
golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
|
||||
golang.org/x/sys v0.21.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
|
||||
golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
|
||||
golang.org/x/sys v0.31.0 h1:ioabZlmFYtWhL+TRYpcnNlLwhyxaM9kWTDEmfnprqik=
|
||||
golang.org/x/sys v0.31.0/go.mod h1:BJP2sWEmIv4KK5OTEluFJCKSidICx8ciO85XgH3Ak8k=
|
||||
golang.org/x/sys v0.32.0 h1:s77OFDvIQeibCmezSnk/q6iAfkdiQaJi4VzroCFrN20=
|
||||
golang.org/x/sys v0.32.0/go.mod h1:BJP2sWEmIv4KK5OTEluFJCKSidICx8ciO85XgH3Ak8k=
|
||||
golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
|
||||
golang.org/x/term v0.0.0-20201117132131-f5c789dd3221/go.mod h1:Nr5EML6q2oocZ2LXRh80K7BxOlk5/8JxuGnuhpl+muw=
|
||||
golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
|
||||
@@ -1597,8 +1603,8 @@ google.golang.org/genproto v0.0.0-20200618031413-b414f8b61790/go.mod h1:jDfRM7Fc
|
||||
google.golang.org/genproto v0.0.0-20200729003335-053ba62fc06f/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
|
||||
google.golang.org/genproto v0.0.0-20200804131852-c06518451d9c/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
|
||||
google.golang.org/genproto v0.0.0-20200825200019-8632dd797987/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
|
||||
google.golang.org/genproto v0.0.0-20241118233622-e639e219e697 h1:ToEetK57OidYuqD4Q5w+vfEnPvPpuTwedCNVohYJfNk=
|
||||
google.golang.org/genproto v0.0.0-20241118233622-e639e219e697/go.mod h1:JJrvXBWRZaFMxBufik1a4RpFw4HhgVtBBWQeQgUj2cc=
|
||||
google.golang.org/genproto v0.0.0-20250303144028-a0af3efb3deb h1:ITgPrl429bc6+2ZraNSzMDk3I95nmQln2fuPstKwFDE=
|
||||
google.golang.org/genproto v0.0.0-20250303144028-a0af3efb3deb/go.mod h1:sAo5UzpjUwgFBCzupwhcLcxHVDK7vG5IqI30YnwX2eE=
|
||||
google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb h1:p31xT4yrYrSM/G4Sn2+TNUkVhFCbG9y8itM2S6Th950=
|
||||
google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb/go.mod h1:jbe3Bkdp+Dh2IrslsFCklNhweNTBgSYanP1UXhJDhKg=
|
||||
google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb h1:TLPQVbx1GJ8VKZxz52VAxl1EBgKXXbTiU9Fc5fZeLn4=
|
||||
@@ -1618,8 +1624,8 @@ google.golang.org/grpc v1.29.1/go.mod h1:itym6AZVZYACWQqET3MqgPpjcuV5QH3BxFS3Iji
|
||||
google.golang.org/grpc v1.30.0/go.mod h1:N36X2cJ7JwdamYAgDz+s+rVMFjt3numwzf/HckM8pak=
|
||||
google.golang.org/grpc v1.31.0/go.mod h1:N36X2cJ7JwdamYAgDz+s+rVMFjt3numwzf/HckM8pak=
|
||||
google.golang.org/grpc v1.33.2/go.mod h1:JMHMWHQWaTccqQQlmk3MJZS+GWXOdAesneDmEnv2fbc=
|
||||
google.golang.org/grpc v1.71.0 h1:kF77BGdPTQ4/JZWMlb9VpJ5pa25aqvVqogsxNHHdeBg=
|
||||
google.golang.org/grpc v1.71.0/go.mod h1:H0GRtasmQOh9LkFoCPDu3ZrwUtD1YGE+b2vYBYd/8Ec=
|
||||
google.golang.org/grpc v1.71.1 h1:ffsFWr7ygTUscGPI0KKK6TLrGz0476KUvvsbqWK0rPI=
|
||||
google.golang.org/grpc v1.71.1/go.mod h1:H0GRtasmQOh9LkFoCPDu3ZrwUtD1YGE+b2vYBYd/8Ec=
|
||||
google.golang.org/grpc/examples v0.0.0-20211102180624-670c133e568e h1:m7aQHHqd0q89mRwhwS9Bx2rjyl/hsFAeta+uGrHsQaU=
|
||||
google.golang.org/grpc/examples v0.0.0-20211102180624-670c133e568e/go.mod h1:gID3PKrg7pWKntu9Ss6zTLJ0ttC0X9IHgREOCZwbCVU=
|
||||
google.golang.org/protobuf v0.0.0-20200109180630-ec00e32a8dfd/go.mod h1:DFci5gLYBciE7Vtevhsrf46CRTquxDuWsQurQQe4oz8=
|
||||
@@ -1636,8 +1642,8 @@ google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp0
|
||||
google.golang.org/protobuf v1.26.0/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc=
|
||||
google.golang.org/protobuf v1.28.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
|
||||
google.golang.org/protobuf v1.28.1/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
|
||||
google.golang.org/protobuf v1.36.5 h1:tPhr+woSbjfYvY6/GPufUoYizxw1cF/yFoxJ2fmpwlM=
|
||||
google.golang.org/protobuf v1.36.5/go.mod h1:9fA7Ob0pmnwhb644+1+CVWFRbNajQ6iRojtC/QF5bRE=
|
||||
google.golang.org/protobuf v1.36.6 h1:z1NpPI8ku2WgiWnf+t9wTPsn6eP1L7ksHUlkfLvd9xY=
|
||||
google.golang.org/protobuf v1.36.6/go.mod h1:jduwjTPXsFjZGTmRluh+L6NjiWu7pchiJ2/5YcXBHnY=
|
||||
gopkg.in/alecthomas/kingpin.v2 v2.2.6/go.mod h1:FMv+mEhP44yOT+4EoQTLFTRgOQ1FBLkstjWtayDeSgw=
|
||||
gopkg.in/cenkalti/backoff.v1 v1.1.0 h1:Arh75ttbsvlpVA7WtVpH4u9h6Zl46xuptxqLxPiSo4Y=
|
||||
gopkg.in/cenkalti/backoff.v1 v1.1.0/go.mod h1:J6Vskwqd+OMVJl8C33mmtxTBs2gyzfv7UDAkHu8BrjI=
|
||||
|
||||
@@ -2716,7 +2716,7 @@ var (
|
||||
|
||||
// errMaxExprCnt is used to signal that the maximum number of
|
||||
// expressions have been parsed.
|
||||
errMaxExprCnt = errors.New("max number of expresssions parsed")
|
||||
errMaxExprCnt = errors.New("max number of expressions parsed")
|
||||
)
|
||||
|
||||
// Option is a function that can set an option on the parser. It returns
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -16,7 +16,7 @@ var (
|
||||
// LatestTag is the latest released version plus the dev meta version.
|
||||
// Will be overwritten by the release pipeline
|
||||
// Needs a manual change for every tagged release
|
||||
LatestTag = "2.0.1+dev"
|
||||
LatestTag = "2.1.0+dev"
|
||||
|
||||
// Date indicates the build date.
|
||||
// This has been removed, it looks like you can only replace static strings with recent go versions
|
||||
@@ -46,18 +46,17 @@ func GetString() string {
|
||||
// Parsed returns a semver Version
|
||||
func Parsed() (version *semver.Version) {
|
||||
versionToParse := LatestTag
|
||||
if Tag != "" {
|
||||
// use the placeholder version if the tag is empty or when we are creating a daily build
|
||||
if Tag != "" && Tag != "daily" {
|
||||
versionToParse = Tag
|
||||
}
|
||||
version, err := semver.NewVersion(versionToParse)
|
||||
// We have no semver version but a commitid
|
||||
if err != nil {
|
||||
// this should never happen
|
||||
if err != nil {
|
||||
return &semver.Version{}
|
||||
}
|
||||
return &semver.Version{}
|
||||
}
|
||||
if String != "" {
|
||||
// We have no tagged version but a commitid
|
||||
nVersion, err := version.SetMetadata(String)
|
||||
if err != nil {
|
||||
return &semver.Version{}
|
||||
|
||||
@@ -33,11 +33,17 @@ See the environment variables for more details.
|
||||
### Maximum Scan Size
|
||||
|
||||
Several factors can make it necessary to limit the maximum filesize the antivirus service uses for scanning.
|
||||
Use the `ANTIVIRUS_MAX_SCAN_SIZE` environment variable to specify the maximum file size to be scanned.
|
||||
Use the `ANTIVIRUS_MAX_SCAN_SIZE` environment variable to scan only a given number of bytes,
|
||||
or to skip the whole resource.
|
||||
|
||||
Even if it's recommended to scan each file, several factors like scanner type and version,
|
||||
Even if it's recommended to scan the whole file, several factors like scanner type and version,
|
||||
bandwidth, performance issues, etc. might make a limit necessary.
|
||||
|
||||
In such cases, the antivirus the max scan size mode can be handy, the following modes are available:
|
||||
|
||||
- `partial`: The file is scanned up to the given size. The rest of the file is not scanned. This is the default mode `ANTIVIRUS_MAX_SCAN_SIZE=partial`
|
||||
- `skip`: The file is skipped and not scanned. `ANTIVIRUS_MAX_SCAN_SIZE=skip`
|
||||
|
||||
**IMPORTANT**
|
||||
> Streaming of files to the virus scan service still [needs to be implemented](https://github.com/owncloud/ocis/issues/6803).
|
||||
> To prevent OOM errors `ANTIVIRUS_MAX_SCAN_SIZE` needs to be set lower than available ram and or the maximum file size that can be scanned by the virus scanner.
|
||||
|
||||
@@ -45,7 +45,7 @@ func Server(cfg *config.Config) *cli.Command {
|
||||
{
|
||||
svc, err := service.NewAntivirus(cfg, logger, traceProvider)
|
||||
if err != nil {
|
||||
return err
|
||||
return cli.Exit(err.Error(), 1)
|
||||
}
|
||||
|
||||
gr.Add(svc.Run, func(_ error) {
|
||||
|
||||
@@ -5,6 +5,26 @@ import (
|
||||
"time"
|
||||
)
|
||||
|
||||
// ScannerType gives info which scanner is used
|
||||
type ScannerType string
|
||||
|
||||
const (
|
||||
// ScannerTypeClamAV defines that clamav is used
|
||||
ScannerTypeClamAV ScannerType = "clamav"
|
||||
// ScannerTypeICap defines that icap is used
|
||||
ScannerTypeICap ScannerType = "icap"
|
||||
)
|
||||
|
||||
// MaxScanSizeMode defines the mode of handling files that exceed the maximum scan size
|
||||
type MaxScanSizeMode string
|
||||
|
||||
const (
|
||||
// MaxScanSizeModeSkip defines that files that are bigger than the max scan size will be skipped
|
||||
MaxScanSizeModeSkip MaxScanSizeMode = "skip"
|
||||
// MaxScanSizeModePartial defines that only the file up to the max size will be used
|
||||
MaxScanSizeModePartial MaxScanSizeMode = "partial"
|
||||
)
|
||||
|
||||
// Config combines all available configuration parts.
|
||||
type Config struct {
|
||||
File string
|
||||
@@ -20,8 +40,9 @@ type Config struct {
|
||||
Events Events
|
||||
Workers int `yaml:"workers" env:"ANTIVIRUS_WORKERS" desc:"The number of concurrent go routines that fetch events from the event queue." introductionVersion:"1.0.0"`
|
||||
|
||||
Scanner Scanner
|
||||
MaxScanSize string `yaml:"max-scan-size" env:"ANTIVIRUS_MAX_SCAN_SIZE" desc:"The maximum scan size the virus scanner can handle. 0 means unlimited. Usable common abbreviations: [KB, KiB, MB, MiB, GB, GiB, TB, TiB, PB, PiB, EB, EiB], example: 2GB." introductionVersion:"1.0.0"`
|
||||
Scanner Scanner
|
||||
MaxScanSize string `yaml:"max-scan-size" env:"ANTIVIRUS_MAX_SCAN_SIZE" desc:"The maximum scan size the virus scanner can handle.0 means unlimited. Usable common abbreviations: [KB, KiB, MB, MiB, GB, GiB, TB, TiB, PB, PiB, EB, EiB], example: 2GB." introductionVersion:"1.0.0"`
|
||||
MaxScanSizeMode MaxScanSizeMode `yaml:"max-scan-size-mode" env:"ANTIVIRUS_MAX_SCAN_SIZE_MODE" desc:"Defines the mode of handling files that exceed the maximum scan size. Supported options are: 'skip', which skips files that are bigger than the max scan size, and 'truncate' (default), which only uses the file up to the max size." introductionVersion:"2.1.0"`
|
||||
|
||||
Context context.Context `json:"-" yaml:"-"`
|
||||
|
||||
@@ -62,7 +83,7 @@ type Events struct {
|
||||
|
||||
// Scanner provides configuration options for the virus scanner
|
||||
type Scanner struct {
|
||||
Type string `yaml:"type" env:"ANTIVIRUS_SCANNER_TYPE" desc:"The antivirus scanner to use. Supported values are 'clamav' and 'icap'." introductionVersion:"1.0.0"`
|
||||
Type ScannerType `yaml:"type" env:"ANTIVIRUS_SCANNER_TYPE" desc:"The antivirus scanner to use. Supported values are 'clamav' and 'icap'." introductionVersion:"1.0.0"`
|
||||
|
||||
ClamAV ClamAV // only if Type == clamav
|
||||
ICAP ICAP // only if Type == icap
|
||||
@@ -70,7 +91,8 @@ type Scanner struct {
|
||||
|
||||
// ClamAV provides configuration option for clamav
|
||||
type ClamAV struct {
|
||||
Socket string `yaml:"socket" env:"ANTIVIRUS_CLAMAV_SOCKET" desc:"The socket clamav is running on. Note the default value is an example which needs adaption according your OS." introductionVersion:"1.0.0"`
|
||||
Socket string `yaml:"socket" env:"ANTIVIRUS_CLAMAV_SOCKET" desc:"The socket clamav is running on. Note the default value is an example which needs adaption according your OS." introductionVersion:"1.0.0"`
|
||||
Timeout time.Duration `yaml:"scan_timeout" env:"ANTIVIRUS_CLAMAV_SCAN_TIMEOUT" desc:"Scan timeout for the ClamAV client. Defaults to '5m' (5 minutes). See the Environment Variable Types description for more details." introductionVersion:"2.1.0"`
|
||||
}
|
||||
|
||||
// ICAP provides configuration options for icap
|
||||
|
||||
@@ -30,10 +30,15 @@ func DefaultConfig() *config.Config {
|
||||
},
|
||||
Workers: 10,
|
||||
InfectedFileHandling: "delete",
|
||||
// defaults from clamav sample conf: MaxScanSize=400M, MaxFileSize=100M, StreamMaxLength=100M
|
||||
// https://github.com/Cisco-Talos/clamav/blob/main/etc/clamd.conf.sample
|
||||
MaxScanSize: "100MB",
|
||||
MaxScanSizeMode: config.MaxScanSizeModePartial,
|
||||
Scanner: config.Scanner{
|
||||
Type: "clamav",
|
||||
Type: config.ScannerTypeClamAV,
|
||||
ClamAV: config.ClamAV{
|
||||
Socket: "/run/clamav/clamd.ctl",
|
||||
Socket: "/run/clamav/clamd.ctl",
|
||||
Timeout: 5 * time.Minute,
|
||||
},
|
||||
ICAP: config.ICAP{
|
||||
URL: "icap://127.0.0.1:1344",
|
||||
@@ -57,4 +62,9 @@ func EnsureDefaults(cfg *config.Config) {
|
||||
|
||||
// Sanitize sanitizes the configuration
|
||||
func Sanitize(cfg *config.Config) {
|
||||
defaultConfig := DefaultConfig()
|
||||
|
||||
if cfg.MaxScanSize == "" {
|
||||
cfg.MaxScanSize = defaultConfig.MaxScanSize
|
||||
}
|
||||
}
|
||||
@@ -1,34 +1,51 @@
|
||||
package scanners
|
||||
|
||||
import (
|
||||
"fmt"
|
||||
"time"
|
||||
|
||||
"github.com/dutchcoders/go-clamd"
|
||||
)
|
||||
|
||||
// NewClamAV returns a Scanner talking to clamAV via socket
|
||||
func NewClamAV(socket string) *ClamAV {
|
||||
return &ClamAV{
|
||||
clamd: clamd.NewClamd(socket),
|
||||
func NewClamAV(socket string, timeout time.Duration) (*ClamAV, error) {
|
||||
c := clamd.NewClamd(socket)
|
||||
|
||||
if err := c.Ping(); err != nil {
|
||||
return nil, fmt.Errorf("%w: %w", ErrScannerNotReachable, err)
|
||||
}
|
||||
|
||||
return &ClamAV{
|
||||
clamd: clamd.NewClamd(socket),
|
||||
timeout: timeout,
|
||||
}, nil
|
||||
}
|
||||
|
||||
// ClamAV is a Scanner based on clamav
|
||||
type ClamAV struct {
|
||||
clamd *clamd.Clamd
|
||||
clamd *clamd.Clamd
|
||||
timeout time.Duration
|
||||
}
|
||||
|
||||
// Scan to fulfill Scanner interface
|
||||
func (s ClamAV) Scan(in Input) (Result, error) {
|
||||
ch, err := s.clamd.ScanStream(in.Body, make(chan bool))
|
||||
abort := make(chan bool, 1)
|
||||
defer close(abort)
|
||||
|
||||
ch, err := s.clamd.ScanStream(in.Body, abort)
|
||||
if err != nil {
|
||||
return Result{}, err
|
||||
}
|
||||
|
||||
r := <-ch
|
||||
return Result{
|
||||
Infected: r.Status == clamd.RES_FOUND,
|
||||
Description: r.Description,
|
||||
ScanTime: time.Now(),
|
||||
}, nil
|
||||
select {
|
||||
case <-time.After(s.timeout):
|
||||
abort <- true
|
||||
return Result{}, fmt.Errorf("%w: %s", ErrScanTimeout, in.Url)
|
||||
case s := <-ch:
|
||||
return Result{
|
||||
Infected: s.Status == clamd.RES_FOUND,
|
||||
Description: s.Description,
|
||||
ScanTime: time.Now(),
|
||||
}, nil
|
||||
}
|
||||
}
|
||||
@@ -0,0 +1,120 @@
|
||||
package scanners_test
|
||||
|
||||
import (
|
||||
"context"
|
||||
"net"
|
||||
"os"
|
||||
"path/filepath"
|
||||
"strings"
|
||||
"testing"
|
||||
"time"
|
||||
|
||||
"github.com/stretchr/testify/assert"
|
||||
"github.com/stretchr/testify/require"
|
||||
|
||||
"github.com/opencloud-eu/opencloud/services/antivirus/pkg/scanners"
|
||||
)
|
||||
|
||||
func newUnixListener(t testing.TB, lc net.ListenConfig, v ...string) net.Listener {
|
||||
d, err := os.MkdirTemp("", "")
|
||||
assert.NoError(t, err)
|
||||
t.Cleanup(func() {
|
||||
require.NoError(t, os.RemoveAll(d))
|
||||
})
|
||||
|
||||
nl, err := lc.Listen(context.Background(), "unix", filepath.Join(d, "sock"))
|
||||
require.NoError(t, err)
|
||||
|
||||
go func() {
|
||||
i := 0
|
||||
for {
|
||||
if len(v) == i {
|
||||
break
|
||||
}
|
||||
|
||||
conn, err := nl.Accept()
|
||||
require.NoError(t, err)
|
||||
|
||||
time.Sleep(100 * time.Millisecond)
|
||||
|
||||
_, err = conn.Write([]byte(v[i]))
|
||||
require.NoError(t, err)
|
||||
require.NoError(t, conn.Close())
|
||||
i++
|
||||
}
|
||||
}()
|
||||
|
||||
return nl
|
||||
}
|
||||
|
||||
func TestNewClamAV(t *testing.T) {
|
||||
t.Run("returns a scanner", func(t *testing.T) {
|
||||
ul := newUnixListener(t, net.ListenConfig{}, "PONG\n")
|
||||
defer func() {
|
||||
assert.NoError(t, ul.Close())
|
||||
}()
|
||||
|
||||
done := make(chan bool, 1)
|
||||
|
||||
go func() {
|
||||
_, err := scanners.NewClamAV(ul.Addr().String(), 10*time.Second)
|
||||
assert.NoError(t, err)
|
||||
done <- true
|
||||
}()
|
||||
|
||||
assert.True(t, <-done)
|
||||
})
|
||||
|
||||
t.Run("fails if scanner is not pingable", func(t *testing.T) {
|
||||
_, err := scanners.NewClamAV("", 0)
|
||||
assert.ErrorIs(t, err, scanners.ErrScannerNotReachable)
|
||||
})
|
||||
}
|
||||
|
||||
func TestNewClamAV_Scan(t *testing.T) {
|
||||
t.Run("returns a result", func(t *testing.T) {
|
||||
ul := newUnixListener(t, net.ListenConfig{}, "PONG\n", "stream: Win.Test.EICAR_HDB-1 FOUND\n")
|
||||
defer func() {
|
||||
assert.NoError(t, ul.Close())
|
||||
}()
|
||||
|
||||
done := make(chan bool, 1)
|
||||
|
||||
go func() {
|
||||
scanner, err := scanners.NewClamAV(ul.Addr().String(), 10*time.Second)
|
||||
assert.NoError(t, err)
|
||||
|
||||
result, err := scanner.Scan(scanners.Input{Body: strings.NewReader("DATA")})
|
||||
assert.NoError(t, err)
|
||||
|
||||
assert.Equal(t, result.Description, "Win.Test.EICAR_HDB-1")
|
||||
assert.True(t, result.Infected)
|
||||
done <- true
|
||||
}()
|
||||
|
||||
assert.True(t, <-done)
|
||||
})
|
||||
|
||||
t.Run("aborts after a certain time", func(t *testing.T) {
|
||||
ul := newUnixListener(t, net.ListenConfig{}, "PONG\n", "stream: Win.Test.EICAR_HDB-1 FOUND\n")
|
||||
defer func() {
|
||||
assert.NoError(t, ul.Close())
|
||||
}()
|
||||
|
||||
done := make(chan bool, 1)
|
||||
|
||||
go func() {
|
||||
scanner, err := scanners.NewClamAV(ul.Addr().String(), 10*time.Second)
|
||||
assert.NoError(t, err)
|
||||
|
||||
result, err := scanner.Scan(scanners.Input{Body: strings.NewReader("DATA")})
|
||||
assert.NoError(t, err)
|
||||
|
||||
assert.Equal(t, result.Description, "Win.Test.EICAR_HDB-1")
|
||||
assert.True(t, result.Infected)
|
||||
done <- true
|
||||
}()
|
||||
|
||||
assert.True(t, <-done)
|
||||
})
|
||||
}
|
||||
@@ -1,21 +1,31 @@
|
||||
package scanners
|
||||
|
||||
import (
|
||||
"errors"
|
||||
"io"
|
||||
"time"
|
||||
)
|
||||
|
||||
// The Result is the common scan result to all scanners
|
||||
type Result struct {
|
||||
Infected bool
|
||||
ScanTime time.Time
|
||||
Description string
|
||||
}
|
||||
var (
|
||||
// ErrScanTimeout is returned when a scan times out
|
||||
ErrScanTimeout = errors.New("time out waiting for clamav to respond while scanning")
|
||||
// ErrScannerNotReachable is returned when the scanner is not reachable
|
||||
ErrScannerNotReachable = errors.New("failed to reach the scanner")
|
||||
)
|
||||
|
||||
// The Input is the common input to all scanners
|
||||
type Input struct {
|
||||
Body io.Reader
|
||||
Size int64
|
||||
Url string
|
||||
Name string
|
||||
}
|
||||
type (
|
||||
// The Result is the common scan result to all scanners
|
||||
Result struct {
|
||||
Infected bool
|
||||
ScanTime time.Time
|
||||
Description string
|
||||
}
|
||||
|
||||
// The Input is the common input to all scanners
|
||||
Input struct {
|
||||
Body io.Reader
|
||||
Size int64
|
||||
Url string
|
||||
Name string
|
||||
}
|
||||
)
|
||||
@@ -9,6 +9,7 @@ import (
|
||||
"io"
|
||||
"net/http"
|
||||
"os"
|
||||
"slices"
|
||||
"sync"
|
||||
"time"
|
||||
|
||||
@@ -37,38 +38,44 @@ type Scanner interface {
|
||||
}
|
||||
|
||||
// NewAntivirus returns a service implementation for Service.
|
||||
func NewAntivirus(c *config.Config, l log.Logger, tp trace.TracerProvider) (Antivirus, error) {
|
||||
|
||||
func NewAntivirus(cfg *config.Config, logger log.Logger, tracerProvider trace.TracerProvider) (Antivirus, error) {
|
||||
var scanner Scanner
|
||||
var err error
|
||||
switch c.Scanner.Type {
|
||||
switch cfg.Scanner.Type {
|
||||
default:
|
||||
return Antivirus{}, fmt.Errorf("unknown av scanner: '%s'", c.Scanner.Type)
|
||||
case "clamav":
|
||||
scanner = scanners.NewClamAV(c.Scanner.ClamAV.Socket)
|
||||
case "icap":
|
||||
scanner, err = scanners.NewICAP(c.Scanner.ICAP.URL, c.Scanner.ICAP.Service, c.Scanner.ICAP.Timeout)
|
||||
return Antivirus{}, fmt.Errorf("unknown av scanner: '%s'", cfg.Scanner.Type)
|
||||
case config.ScannerTypeClamAV:
|
||||
scanner, err = scanners.NewClamAV(cfg.Scanner.ClamAV.Socket, cfg.Scanner.ClamAV.Timeout)
|
||||
case config.ScannerTypeICap:
|
||||
scanner, err = scanners.NewICAP(cfg.Scanner.ICAP.URL, cfg.Scanner.ICAP.Service, cfg.Scanner.ICAP.Timeout)
|
||||
}
|
||||
if err != nil {
|
||||
return Antivirus{}, err
|
||||
}
|
||||
|
||||
av := Antivirus{c: c, l: l, tp: tp, s: scanner, client: rhttp.GetHTTPClient(rhttp.Insecure(true))}
|
||||
av := Antivirus{config: cfg, log: logger, tracerProvider: tracerProvider, scanner: scanner, client: rhttp.GetHTTPClient(rhttp.Insecure(true))}
|
||||
|
||||
switch o := events.PostprocessingOutcome(c.InfectedFileHandling); o {
|
||||
case events.PPOutcomeContinue, events.PPOutcomeAbort, events.PPOutcomeDelete:
|
||||
av.o = o
|
||||
switch mode := cfg.MaxScanSizeMode; mode {
|
||||
case config.MaxScanSizeModeSkip, config.MaxScanSizeModePartial:
|
||||
break
|
||||
default:
|
||||
return av, fmt.Errorf("unknown infected file handling '%s'", o)
|
||||
return av, fmt.Errorf("unknown max scan size mode '%s'", cfg.MaxScanSizeMode)
|
||||
}
|
||||
|
||||
if c.MaxScanSize != "" {
|
||||
b, err := bytesize.Parse(c.MaxScanSize)
|
||||
switch outcome := events.PostprocessingOutcome(cfg.InfectedFileHandling); outcome {
|
||||
case events.PPOutcomeContinue, events.PPOutcomeAbort, events.PPOutcomeDelete:
|
||||
av.outcome = outcome
|
||||
default:
|
||||
return av, fmt.Errorf("unknown infected file handling '%s'", outcome)
|
||||
}
|
||||
|
||||
if cfg.MaxScanSize != "" {
|
||||
b, err := bytesize.Parse(cfg.MaxScanSize)
|
||||
if err != nil {
|
||||
return av, err
|
||||
}
|
||||
|
||||
av.m = b.Bytes()
|
||||
av.maxScanSize = b.Bytes()
|
||||
}
|
||||
|
||||
return av, nil
|
||||
@@ -76,23 +83,23 @@ func NewAntivirus(c *config.Config, l log.Logger, tp trace.TracerProvider) (Anti
|
||||
|
||||
// Antivirus defines implements the business logic for Service.
|
||||
type Antivirus struct {
|
||||
c *config.Config
|
||||
l log.Logger
|
||||
s Scanner
|
||||
o events.PostprocessingOutcome
|
||||
m uint64
|
||||
tp trace.TracerProvider
|
||||
config *config.Config
|
||||
log log.Logger
|
||||
scanner Scanner
|
||||
outcome events.PostprocessingOutcome
|
||||
maxScanSize uint64
|
||||
tracerProvider trace.TracerProvider
|
||||
|
||||
client *http.Client
|
||||
}
|
||||
|
||||
// Run runs the service
|
||||
func (av Antivirus) Run() error {
|
||||
evtsCfg := av.c.Events
|
||||
eventsCfg := av.config.Events
|
||||
|
||||
var rootCAPool *x509.CertPool
|
||||
if av.c.Events.TLSRootCACertificate != "" {
|
||||
rootCrtFile, err := os.Open(evtsCfg.TLSRootCACertificate)
|
||||
if av.config.Events.TLSRootCACertificate != "" {
|
||||
rootCrtFile, err := os.Open(eventsCfg.TLSRootCACertificate)
|
||||
if err != nil {
|
||||
return err
|
||||
}
|
||||
@@ -104,10 +111,10 @@ func (av Antivirus) Run() error {
|
||||
|
||||
rootCAPool = x509.NewCertPool()
|
||||
rootCAPool.AppendCertsFromPEM(certBytes.Bytes())
|
||||
av.c.Events.TLSInsecure = false
|
||||
av.config.Events.TLSInsecure = false
|
||||
}
|
||||
|
||||
natsStream, err := stream.NatsFromConfig(av.c.Service.Name, false, stream.NatsConfig(av.c.Events))
|
||||
natsStream, err := stream.NatsFromConfig(av.config.Service.Name, false, stream.NatsConfig(av.config.Events))
|
||||
if err != nil {
|
||||
return err
|
||||
}
|
||||
@@ -118,7 +125,7 @@ func (av Antivirus) Run() error {
|
||||
}
|
||||
|
||||
wg := sync.WaitGroup{}
|
||||
for i := 0; i < av.c.Workers; i++ {
|
||||
for i := 0; i < av.config.Workers; i++ {
|
||||
wg.Add(1)
|
||||
go func() {
|
||||
defer wg.Done()
|
||||
@@ -127,11 +134,11 @@ func (av Antivirus) Run() error {
|
||||
if err != nil {
|
||||
switch {
|
||||
case errors.Is(err, ErrFatal):
|
||||
av.l.Fatal().Err(err).Msg("fatal error - exiting")
|
||||
av.log.Fatal().Err(err).Msg("fatal error - exiting")
|
||||
case errors.Is(err, ErrEvent):
|
||||
av.l.Error().Err(err).Msg("continuing")
|
||||
av.log.Error().Err(err).Msg("continuing")
|
||||
default:
|
||||
av.l.Fatal().Err(err).Msg("unknown error - exiting")
|
||||
av.log.Fatal().Err(err).Msg("unknown error - exiting")
|
||||
}
|
||||
}
|
||||
}
|
||||
@@ -143,20 +150,20 @@ func (av Antivirus) Run() error {
|
||||
}
|
||||
|
||||
func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
ctx := e.GetTraceContext(context.Background())
|
||||
ctx, span := av.tp.Tracer("antivirus").Start(ctx, "processEvent")
|
||||
ctx, span := av.tracerProvider.Tracer("antivirus").Start(e.GetTraceContext(context.Background()), "processEvent")
|
||||
defer span.End()
|
||||
av.l.Info().Str("traceID", span.SpanContext().TraceID().String()).Msg("TraceID")
|
||||
av.log.Info().Str("traceID", span.SpanContext().TraceID().String()).Msg("TraceID")
|
||||
|
||||
ev := e.Event.(events.StartPostprocessingStep)
|
||||
if ev.StepToStart != events.PPStepAntivirus {
|
||||
return nil
|
||||
}
|
||||
|
||||
if av.c.DebugScanOutcome != "" {
|
||||
av.l.Warn().Str("antivir, clamav", ">>>>>>> ANTIVIRUS_DEBUG_SCAN_OUTCOME IS SET NO ACTUAL VIRUS SCAN IS PERFORMED!").Send()
|
||||
if av.config.DebugScanOutcome != "" {
|
||||
av.log.Warn().Str("antivir, clamav", ">>>>>>> ANTIVIRUS_DEBUG_SCAN_OUTCOME IS SET NO ACTUAL VIRUS SCAN IS PERFORMED!").Send()
|
||||
if err := events.Publish(ctx, s, events.PostprocessingStepFinished{
|
||||
FinishedStep: events.PPStepAntivirus,
|
||||
Outcome: events.PostprocessingOutcome(av.c.DebugScanOutcome),
|
||||
Outcome: events.PostprocessingOutcome(av.config.DebugScanOutcome),
|
||||
UploadID: ev.UploadID,
|
||||
ExecutingUser: ev.ExecutingUser,
|
||||
Filename: ev.Filename,
|
||||
@@ -167,13 +174,14 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
ResourceID: ev.ResourceID,
|
||||
},
|
||||
}); err != nil {
|
||||
av.l.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
|
||||
av.log.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
|
||||
return fmt.Errorf("%w: cannot publish events", ErrFatal)
|
||||
}
|
||||
return fmt.Errorf("%w: no actual virus scan performed", ErrEvent)
|
||||
}
|
||||
|
||||
av.l.Debug().Str("uploadid", ev.UploadID).Str("filename", ev.Filename).Msg("Starting virus scan.")
|
||||
av.log.Debug().Str("uploadid", ev.UploadID).Str("filename", ev.Filename).Msg("Starting virus scan.")
|
||||
|
||||
var errmsg string
|
||||
start := time.Now()
|
||||
res, err := av.process(ev)
|
||||
@@ -185,17 +193,17 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
var outcome events.PostprocessingOutcome
|
||||
switch {
|
||||
case res.Infected:
|
||||
outcome = av.o
|
||||
outcome = av.outcome
|
||||
case !res.Infected && err == nil:
|
||||
outcome = events.PPOutcomeContinue
|
||||
case err != nil:
|
||||
outcome = events.PPOutcomeRetry
|
||||
default:
|
||||
// Not sure what this is about. abort.
|
||||
// Not sure what this is about. Abort.
|
||||
outcome = events.PPOutcomeAbort
|
||||
}
|
||||
|
||||
av.l.Info().Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Str("virus", res.Description).Str("outcome", string(outcome)).Str("filename", ev.Filename).Str("user", ev.ExecutingUser.GetId().GetOpaqueId()).Bool("infected", res.Infected).Dur("duration", duration).Msg("File scanned")
|
||||
av.log.Info().Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Str("virus", res.Description).Str("outcome", string(outcome)).Str("filename", ev.Filename).Str("user", ev.ExecutingUser.GetId().GetOpaqueId()).Bool("infected", res.Infected).Dur("duration", duration).Msg("File scanned")
|
||||
if err := events.Publish(ctx, s, events.PostprocessingStepFinished{
|
||||
FinishedStep: events.PPStepAntivirus,
|
||||
Outcome: outcome,
|
||||
@@ -210,7 +218,7 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
ErrorMsg: errmsg,
|
||||
},
|
||||
}); err != nil {
|
||||
av.l.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
|
||||
av.log.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
|
||||
return fmt.Errorf("%w: %s", ErrFatal, err)
|
||||
}
|
||||
return nil
|
||||
@@ -218,11 +226,24 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
|
||||
// process the scan
|
||||
func (av Antivirus) process(ev events.StartPostprocessingStep) (scanners.Result, error) {
|
||||
if ev.Filesize == 0 || (0 < av.m && av.m < ev.Filesize) {
|
||||
av.l.Info().Str("uploadid", ev.UploadID).Uint64("limit", av.m).Uint64("filesize", ev.Filesize).Msg("Skipping file to be virus scanned because its file size is higher than the defined limit.")
|
||||
return scanners.Result{
|
||||
ScanTime: time.Now(),
|
||||
}, nil
|
||||
if ev.Filesize == 0 {
|
||||
av.log.Info().Str("uploadid", ev.UploadID).Msg("Skipping file to be virus scanned, file size is 0.")
|
||||
return scanners.Result{ScanTime: time.Now()}, nil
|
||||
}
|
||||
|
||||
headers := make(map[string]string)
|
||||
switch {
|
||||
case av.maxScanSize == 0:
|
||||
// there is no size limit
|
||||
break
|
||||
case av.config.MaxScanSizeMode == config.MaxScanSizeModeSkip && ev.Filesize > av.maxScanSize:
|
||||
// skip the file if it is bigger than the max scan size
|
||||
av.log.Info().Str("uploadid", ev.UploadID).Uint64("filesize", ev.Filesize).
|
||||
Msg("Skipping file to be virus scanned, file size is bigger than max scan size.")
|
||||
return scanners.Result{ScanTime: time.Now()}, nil
|
||||
case av.config.MaxScanSizeMode == config.MaxScanSizeModePartial && ev.Filesize > av.maxScanSize:
|
||||
// set the range header to only download the first maxScanSize bytes
|
||||
headers["Range"] = fmt.Sprintf("bytes=0-%d", av.maxScanSize-1)
|
||||
}
|
||||
|
||||
var err error
|
||||
@@ -230,56 +251,61 @@ func (av Antivirus) process(ev events.StartPostprocessingStep) (scanners.Result,
|
||||
|
||||
switch ev.UploadID {
|
||||
default:
|
||||
rrc, err = av.downloadViaToken(ev.URL)
|
||||
rrc, err = av.downloadViaToken(ev.URL, headers)
|
||||
case "":
|
||||
rrc, err = av.downloadViaReva(ev.URL, ev.Token, ev.RevaToken)
|
||||
rrc, err = av.downloadViaReva(ev.URL, ev.Token, ev.RevaToken, headers)
|
||||
}
|
||||
if err != nil {
|
||||
av.l.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error downloading file")
|
||||
av.log.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error downloading file")
|
||||
return scanners.Result{}, err
|
||||
}
|
||||
defer rrc.Close()
|
||||
av.l.Debug().Str("uploadid", ev.UploadID).Msg("Downloaded file successfully, starting virusscan")
|
||||
defer func() {
|
||||
_ = rrc.Close()
|
||||
}()
|
||||
|
||||
res, err := av.s.Scan(scanners.Input{Body: rrc, Size: int64(ev.Filesize), Url: ev.URL, Name: ev.Filename})
|
||||
av.log.Debug().Str("uploadid", ev.UploadID).Msg("Downloaded file successfully, starting virusscan")
|
||||
|
||||
res, err := av.scanner.Scan(scanners.Input{Body: rrc, Size: int64(ev.Filesize), Url: ev.URL, Name: ev.Filename})
|
||||
if err != nil {
|
||||
av.l.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error scanning file")
|
||||
av.log.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error scanning file")
|
||||
}
|
||||
|
||||
return res, err
|
||||
}
|
||||
|
||||
// download will download the file
|
||||
func (av Antivirus) downloadViaToken(url string) (io.ReadCloser, error) {
|
||||
func (av Antivirus) downloadViaToken(url string, headers map[string]string) (io.ReadCloser, error) {
|
||||
req, err := http.NewRequest(http.MethodGet, url, nil)
|
||||
if err != nil {
|
||||
return nil, err
|
||||
}
|
||||
|
||||
return av.doDownload(req)
|
||||
return av.doDownload(req, headers)
|
||||
}
|
||||
|
||||
// download will download the file
|
||||
func (av Antivirus) downloadViaReva(url string, dltoken string, revatoken string) (io.ReadCloser, error) {
|
||||
ctx := ctxpkg.ContextSetToken(context.Background(), revatoken)
|
||||
|
||||
req, err := rhttp.NewRequest(ctx, http.MethodGet, url, nil)
|
||||
func (av Antivirus) downloadViaReva(url string, dltoken string, revatoken string, headers map[string]string) (io.ReadCloser, error) {
|
||||
req, err := rhttp.NewRequest(ctxpkg.ContextSetToken(context.Background(), revatoken), http.MethodGet, url, nil)
|
||||
if err != nil {
|
||||
return nil, err
|
||||
}
|
||||
req.Header.Set("X-Reva-Transfer", dltoken)
|
||||
|
||||
return av.doDownload(req)
|
||||
return av.doDownload(req, headers)
|
||||
}
|
||||
|
||||
func (av Antivirus) doDownload(req *http.Request) (io.ReadCloser, error) {
|
||||
func (av Antivirus) doDownload(req *http.Request, headers map[string]string) (io.ReadCloser, error) {
|
||||
for k, v := range headers {
|
||||
req.Header.Add(k, v)
|
||||
}
|
||||
|
||||
res, err := av.client.Do(req)
|
||||
if err != nil {
|
||||
return nil, err
|
||||
}
|
||||
|
||||
if res.StatusCode != http.StatusOK {
|
||||
res.Body.Close()
|
||||
if !slices.Contains([]int{http.StatusOK, http.StatusPartialContent}, res.StatusCode) {
|
||||
_ = res.Body.Close()
|
||||
return nil, fmt.Errorf("unexpected status code from Download %v", res.StatusCode)
|
||||
}
|
||||
|
||||
|
||||
@@ -11,7 +11,6 @@ import (
|
||||
gateway "github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1"
|
||||
group "github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1"
|
||||
user "github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1"
|
||||
rpc "github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1"
|
||||
provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1"
|
||||
"go.opentelemetry.io/otel/trace"
|
||||
|
||||
@@ -219,33 +218,16 @@ func processShareEvent(ctx context.Context, ref *provider.Reference, gwc gateway
|
||||
|
||||
// custom logic for item trashed event
|
||||
func processItemTrashedEvent(ctx context.Context, ref *provider.Reference, gwc gateway.GatewayAPIClient, initiatorid string, itemID *provider.ResourceId) ([]string, FileEvent, error) {
|
||||
resp, err := gwc.ListRecycle(ctx, &provider.ListRecycleRequest{
|
||||
Ref: ref,
|
||||
Key: itemID.GetOpaqueId(),
|
||||
})
|
||||
if err != nil {
|
||||
return nil, FileEvent{}, err
|
||||
}
|
||||
if resp.GetStatus().GetCode() != rpc.Code_CODE_OK {
|
||||
return nil, FileEvent{}, fmt.Errorf("error listing recycle: %s", resp.GetStatus().GetMessage())
|
||||
data := FileEvent{
|
||||
ItemID: storagespace.FormatResourceID(itemID),
|
||||
// TODO: check with web if parentID is needed
|
||||
// ParentItemID: storagespace.FormatResourceID(*item.GetRef().GetResourceId()),
|
||||
SpaceID: storagespace.FormatStorageID(itemID.GetStorageId(), itemID.GetSpaceId()),
|
||||
InitiatorID: initiatorid,
|
||||
}
|
||||
|
||||
for _, item := range resp.GetRecycleItems() {
|
||||
if item.GetKey() == itemID.GetOpaqueId() {
|
||||
|
||||
data := FileEvent{
|
||||
ItemID: storagespace.FormatResourceID(itemID),
|
||||
// TODO: check with web if parentID is needed
|
||||
// ParentItemID: storagespace.FormatResourceID(*item.GetRef().GetResourceId()),
|
||||
SpaceID: storagespace.FormatStorageID(itemID.GetStorageId(), itemID.GetSpaceId()),
|
||||
InitiatorID: initiatorid,
|
||||
}
|
||||
|
||||
users, err := utils.GetSpaceMembers(ctx, itemID.GetSpaceId(), gwc, utils.ViewerRole)
|
||||
return users, data, err
|
||||
}
|
||||
}
|
||||
return nil, FileEvent{}, errors.New("item not found in recycle bin")
|
||||
users, err := utils.GetSpaceMembers(ctx, itemID.GetSpaceId(), gwc, utils.ViewerRole)
|
||||
return users, data, err
|
||||
}
|
||||
|
||||
// adds share related data to the FileEvent
|
||||
|
||||
@@ -34,6 +34,7 @@ type Config struct {
|
||||
EnableFederatedSharingIncoming bool `yaml:"enable_federated_sharing_incoming" env:"OC_ENABLE_OCM;FRONTEND_ENABLE_FEDERATED_SHARING_INCOMING" desc:"Changing this value is NOT supported. Enables support for incoming federated sharing for clients. The backend behaviour is not changed." introductionVersion:"1.0.0"`
|
||||
EnableFederatedSharingOutgoing bool `yaml:"enable_federated_sharing_outgoing" env:"OC_ENABLE_OCM;FRONTEND_ENABLE_FEDERATED_SHARING_OUTGOING" desc:"Changing this value is NOT supported. Enables support for outgoing federated sharing for clients. The backend behaviour is not changed." introductionVersion:"1.0.0"`
|
||||
SearchMinLength int `yaml:"search_min_length" env:"FRONTEND_SEARCH_MIN_LENGTH" desc:"Minimum number of characters to enter before a client should start a search for Share receivers. This setting can be used to customize the user experience if e.g too many results are displayed." introductionVersion:"1.0.0"`
|
||||
Edition string `yaml:"edition" env:"OC_EDITION;FRONTEND_EDITION" desc:"Edition of OpenCloud. Used for branding purposes." introductionVersion:"1.0.0"`
|
||||
DisableSSE bool `yaml:"disable_sse" env:"OC_DISABLE_SSE;FRONTEND_DISABLE_SSE" desc:"When set to true, clients are informed that the Server-Sent Events endpoint is not accessible." introductionVersion:"1.0.0"`
|
||||
DefaultLinkPermissions int `yaml:"default_link_permissions" env:"FRONTEND_DEFAULT_LINK_PERMISSIONS" desc:"Defines the default permissions a link is being created with. Possible values are 0 (= internal link, for instance members only) and 1 (= public link with viewer permissions). Defaults to 1." introductionVersion:"1.0.0"`
|
||||
|
||||
|
||||
@@ -87,6 +87,7 @@ func DefaultConfig() *config.Config {
|
||||
DefaultUploadProtocol: "tus",
|
||||
DefaultLinkPermissions: 1,
|
||||
SearchMinLength: 3,
|
||||
Edition: "",
|
||||
Checksums: config.Checksums{
|
||||
SupportedTypes: []string{"sha1", "md5", "adler32"},
|
||||
PreferredUploadType: "sha1",
|
||||
|
||||
@@ -208,6 +208,7 @@ func FrontendConfigFromStruct(cfg *config.Config, logger log.Logger) (map[string
|
||||
"needsDbUpgrade": false,
|
||||
"version": version.Legacy,
|
||||
"versionstring": version.LegacyString,
|
||||
"edition": cfg.Edition,
|
||||
"productname": "OpenCloud",
|
||||
"product": "OpenCloud",
|
||||
"productversion": version.GetString(),
|
||||
|
||||
@@ -83,6 +83,7 @@ func NewDriveItemPermissionsService(logger log.Logger, gatewaySelector pool.Sele
|
||||
gatewaySelector: gatewaySelector,
|
||||
identityCache: identityCache,
|
||||
config: config,
|
||||
availableRoles: unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(config.UnifiedRoles.AvailableRoles...)),
|
||||
},
|
||||
}, nil
|
||||
}
|
||||
|
||||
@@ -441,7 +441,6 @@ var _ = Describe("DriveItemPermissionsService", func() {
|
||||
})
|
||||
It("returns role denied", func() {
|
||||
statResponse.Info.PermissionSet = roleconversions.NewManagerRole().CS3ResourcePermissions()
|
||||
cfg.UnifiedRoles.AvailableRoles = []string{unifiedrole.UnifiedRoleViewerID, unifiedrole.UnifiedRoleDeniedID, unifiedrole.UnifiedRoleManagerID}
|
||||
listSharesResponse.Shares = []*collaboration.Share{
|
||||
{
|
||||
Id: &collaboration.ShareId{OpaqueId: "1"},
|
||||
@@ -465,11 +464,15 @@ var _ = Describe("DriveItemPermissionsService", func() {
|
||||
}
|
||||
listPublicSharesResponse.Share = []*link.PublicShare{}
|
||||
|
||||
cfg = defaults.FullDefaultConfig()
|
||||
cfg.UnifiedRoles.AvailableRoles = []string{unifiedrole.UnifiedRoleViewerID, unifiedrole.UnifiedRoleDeniedID, unifiedrole.UnifiedRoleManagerID}
|
||||
service, err := svc.NewDriveItemPermissionsService(log.NewLogger(), gatewaySelector, cache, cfg)
|
||||
|
||||
gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil)
|
||||
gatewayClient.On("ListShares", mock.Anything, mock.Anything).Return(listSharesResponse, nil)
|
||||
gatewayClient.On("GetUser", mock.Anything, mock.Anything).Return(getUserResponse, nil)
|
||||
gatewayClient.On("ListPublicShares", mock.Anything, mock.Anything).Return(listPublicSharesResponse, nil)
|
||||
permissions, err := driveItemPermissionsService.ListPermissions(context.Background(), itemID, false, false)
|
||||
permissions, err := service.ListPermissions(context.Background(), itemID, false, false)
|
||||
Expect(err).ToNot(HaveOccurred())
|
||||
Expect(len(permissions.LibreGraphPermissionsActionsAllowedValues)).ToNot(BeZero())
|
||||
Expect(len(permissions.LibreGraphPermissionsRolesAllowedValues)).ToNot(BeZero())
|
||||
|
||||
@@ -46,6 +46,7 @@ type BaseGraphService struct {
|
||||
gatewaySelector pool.Selectable[gateway.GatewayAPIClient]
|
||||
identityCache identity.IdentityCache
|
||||
config *config.Config
|
||||
availableRoles []*libregraph.UnifiedRoleDefinition
|
||||
}
|
||||
|
||||
func (g BaseGraphService) getSpaceRootPermissions(ctx context.Context, spaceID *storageprovider.StorageSpaceId) ([]libregraph.Permission, error) {
|
||||
@@ -86,8 +87,7 @@ func (g BaseGraphService) CS3ReceivedSharesToDriveItems(ctx context.Context, rec
|
||||
return nil, err
|
||||
}
|
||||
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
return cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, availableRoles)
|
||||
return cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, g.availableRoles)
|
||||
}
|
||||
|
||||
func (g BaseGraphService) CS3ReceivedOCMSharesToDriveItems(ctx context.Context, receivedShares []*ocm.ReceivedShare) ([]libregraph.DriveItem, error) {
|
||||
@@ -96,8 +96,7 @@ func (g BaseGraphService) CS3ReceivedOCMSharesToDriveItems(ctx context.Context,
|
||||
return nil, err
|
||||
}
|
||||
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
return cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, availableRoles)
|
||||
return cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, g.availableRoles)
|
||||
}
|
||||
|
||||
func (g BaseGraphService) cs3SpacePermissionsToLibreGraph(ctx context.Context, space *storageprovider.StorageSpace, apiVersion APIVersion) []libregraph.Permission {
|
||||
@@ -196,9 +195,8 @@ func (g BaseGraphService) cs3SpacePermissionsToLibreGraph(ctx context.Context, s
|
||||
p.SetExpirationDateTime(time.Unix(int64(exp.GetSeconds()), int64(exp.GetNanos())))
|
||||
}
|
||||
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
if role := unifiedrole.CS3ResourcePermissionsToRole(
|
||||
availableRoles,
|
||||
g.availableRoles,
|
||||
perm,
|
||||
unifiedrole.UnifiedRoleConditionDrive,
|
||||
false,
|
||||
@@ -601,7 +599,7 @@ func (g BaseGraphService) cs3UserShareToPermission(ctx context.Context, share *c
|
||||
perm.SetCreatedDateTime(cs3TimestampToTime(share.GetCtime()))
|
||||
}
|
||||
role := unifiedrole.CS3ResourcePermissionsToRole(
|
||||
unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...)),
|
||||
g.availableRoles,
|
||||
share.GetPermissions().GetPermissions(),
|
||||
roleCondition,
|
||||
false,
|
||||
@@ -689,9 +687,8 @@ func (g BaseGraphService) cs3OCMShareToPermission(ctx context.Context, share *oc
|
||||
}
|
||||
}
|
||||
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
role := unifiedrole.CS3ResourcePermissionsToRole(
|
||||
availableRoles,
|
||||
g.availableRoles,
|
||||
permissions,
|
||||
roleCondition,
|
||||
true,
|
||||
|
||||
@@ -14,7 +14,7 @@ import (
|
||||
// GetRoleDefinitions a list of permission roles than can be used when sharing with users or groups
|
||||
func (g Graph) GetRoleDefinitions(w http.ResponseWriter, r *http.Request) {
|
||||
render.Status(r, http.StatusOK)
|
||||
render.JSON(w, r, unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...)))
|
||||
render.JSON(w, r, g.availableRoles)
|
||||
}
|
||||
|
||||
// GetRoleDefinition a permission role than can be used when sharing with users or groups
|
||||
|
||||
@@ -31,6 +31,7 @@ import (
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/identity"
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/identity/ldap"
|
||||
graphm "github.com/opencloud-eu/opencloud/services/graph/pkg/middleware"
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/unifiedrole"
|
||||
)
|
||||
|
||||
const (
|
||||
@@ -148,6 +149,7 @@ func NewService(opts ...Option) (Graph, error) { //nolint:maintidx
|
||||
identityCache: identityCache,
|
||||
gatewaySelector: options.GatewaySelector,
|
||||
config: options.Config,
|
||||
availableRoles: unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(options.Config.UnifiedRoles.AvailableRoles...)),
|
||||
},
|
||||
mux: m,
|
||||
specialDriveItemsCache: spacePropertiesCache,
|
||||
|
||||
@@ -10,7 +10,6 @@ import (
|
||||
libregraph "github.com/owncloud/libre-graph-api-go"
|
||||
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/errorcode"
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/unifiedrole"
|
||||
)
|
||||
|
||||
// ListSharedWithMe lists the files shared with the current user.
|
||||
@@ -40,8 +39,7 @@ func (g Graph) listSharedWithMe(ctx context.Context) ([]libregraph.DriveItem, er
|
||||
g.logger.Error().Err(err).Msg("listing shares failed")
|
||||
return nil, err
|
||||
}
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
driveItems, err := cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedSharesResponse.GetShares(), availableRoles)
|
||||
driveItems, err := cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedSharesResponse.GetShares(), g.availableRoles)
|
||||
if err != nil {
|
||||
g.logger.Error().Err(err).Msg("could not convert received shares to drive items")
|
||||
return nil, err
|
||||
@@ -53,7 +51,7 @@ func (g Graph) listSharedWithMe(ctx context.Context) ([]libregraph.DriveItem, er
|
||||
g.logger.Error().Err(err).Msg("listing shares failed")
|
||||
return nil, err
|
||||
}
|
||||
ocmDriveItems, err := cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedOCMSharesResponse.GetShares(), availableRoles)
|
||||
ocmDriveItems, err := cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedOCMSharesResponse.GetShares(), g.availableRoles)
|
||||
if err != nil {
|
||||
g.logger.Error().Err(err).Msg("could not convert received ocm shares to drive items")
|
||||
return nil, err
|
||||
|
||||
@@ -17,15 +17,16 @@ node-generate-prod: assets
|
||||
.PHONY: assets
|
||||
assets: pnpm-build \
|
||||
assets/identifier/static \
|
||||
assets/identifier/static/favicon.ico \
|
||||
assets/identifier/static/favicon.svg \
|
||||
assets/identifier/static/icon-lilac.svg
|
||||
|
||||
assets/identifier/static:
|
||||
mkdir -p assets/identifier/static
|
||||
|
||||
.PHONY: assets/identifier/static/favicon.ico # force overwrite
|
||||
assets/identifier/static/favicon.ico:
|
||||
cp src/images/favicon.ico assets/identifier/static/favicon.ico
|
||||
.PHONY: assets/identifier/static/favicon.svg # force overwrite
|
||||
assets/identifier/static/favicon.svg:
|
||||
cp src/images/favicon.svg assets/identifier/static/favicon.svg
|
||||
rm assets/identifier/static/favicon.ico
|
||||
|
||||
.PHONY: assets/identifier/static/icon-lilac.svg
|
||||
assets/identifier/static/icon-lilac.svg:
|
||||
|
||||
@@ -102,7 +102,7 @@
|
||||
"redux-logger": "^3.0.6",
|
||||
"redux-thunk": "^2.4.2",
|
||||
"render-if": "^0.1.1",
|
||||
"web-vitals": "^3.5.2"
|
||||
"web-vitals": "^4.2.4"
|
||||
},
|
||||
"devDependencies": {
|
||||
"@babel/core": "7.26.10",
|
||||
@@ -125,7 +125,7 @@
|
||||
"eslint-plugin-i18next": "^6.1.1",
|
||||
"eslint-plugin-import": "^2.30.0",
|
||||
"eslint-plugin-jest": "^24.7.0",
|
||||
"eslint-plugin-jsx-a11y": "^6.9.0",
|
||||
"eslint-plugin-jsx-a11y": "^6.10.2",
|
||||
"eslint-plugin-react": "^7.37.2",
|
||||
"eslint-plugin-react-hooks": "^4.6.2",
|
||||
"eslint-plugin-testing-library": "^3.10.2",
|
||||
@@ -148,7 +148,7 @@
|
||||
"resolve-url-loader": "^5.0.0",
|
||||
"sass-loader": "^16.0.4",
|
||||
"source-map-explorer": "^2.5.3",
|
||||
"typescript": "^5.7.3",
|
||||
"typescript": "^5.8.3",
|
||||
"url-loader": "4.1.1",
|
||||
"webpack": "5.96.1",
|
||||
"webpack-manifest-plugin": "5.0.0",
|
||||
|
||||
Generated
+910
-297
File diff suppressed because it is too large.
Load diff
@@ -4,7 +4,7 @@
|
||||
<meta charset="utf-8">
|
||||
<meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no">
|
||||
<meta name="theme-color" content="#1b223d">
|
||||
<link rel="shortcut icon" href="%PUBLIC_URL%/static/favicon.ico" type="image/x-icon">
|
||||
<link rel="icon" href="%PUBLIC_URL%/static/favicon.svg" type="image/svg+xml">
|
||||
<meta property="csp-nonce" content="__CSP_NONCE__">
|
||||
<title>Sign in - OpenCloud</title>
|
||||
</head>
|
||||
|
||||
Binary file not shown.
|
Before Width: | Height: | Size: 15 KiB |
@@ -0,0 +1,3 @@
|
||||
<svg xmlns="http://www.w3.org/2000/svg" version="1.1" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:svgjs="http://svgjs.dev/svgjs" width="512" height="512"><svg id="SvgjsSvg1001" xmlns="http://www.w3.org/2000/svg" width="512" height="512" viewBox="0 0 512 512"><rect x=".02" y="0" width="512" height="512" fill="#20434f"></rect><polygon points="255.98 342.75 271.89 333.57 271.89 267.12 329.08 234.1 329.08 215.78 313.18 206.6 255.6 239.84 198.83 207.06 182.93 216.24 182.93 234.56 240.12 267.58 240.12 333.59 255.98 342.75" fill="#e2baff"></polygon><polygon points="401.95 150.82 256 66.56 256 66.56 256 66.56 110.05 150.82 110.05 187.5 256 103.24 401.95 187.5 401.95 150.82" fill="#e2baff"></polygon><polygon points="401.95 324.5 256 408.76 110.06 324.5 110.06 361.17 256 445.43 256 445.43 256 445.43 401.95 361.17 401.95 324.5" fill="#e2baff"></polygon></svg><style>@media (prefers-color-scheme: light) { :root { filter: none; } }
|
||||
@media (prefers-color-scheme: dark) { :root { filter: none; } }
|
||||
</style></svg>
|
||||
|
After Width: | Height: | Size: 1015 B |
@@ -77,6 +77,7 @@ func Server(cfg *config.Config) *cli.Command {
|
||||
ocdav.Product(cfg.Status.Product),
|
||||
ocdav.Version(cfg.Status.Version),
|
||||
ocdav.VersionString(cfg.Status.VersionString),
|
||||
ocdav.Edition(cfg.Status.Edition),
|
||||
ocdav.MachineAuthAPIKey(cfg.MachineAuthAPIKey),
|
||||
ocdav.Broker(broker.NoOp{}),
|
||||
// ocdav.FavoriteManager() // FIXME needs a proper persistence implementation https://github.com/owncloud/ocis/issues/1228
|
||||
|
||||
@@ -81,4 +81,5 @@ type Status struct {
|
||||
Product string
|
||||
ProductName string
|
||||
ProductVersion string
|
||||
Edition string `yaml:"edition" env:"OC_EDITION;OCDAV_EDITION" desc:"Edition of OpenCloud. Used for branding purposes." introductionVersion:"1.0.0"`
|
||||
}
|
||||
@@ -92,6 +92,7 @@ func DefaultConfig() *config.Config {
|
||||
ProductVersion: version.GetString(),
|
||||
Product: "OpenCloud",
|
||||
ProductName: "OpenCloud",
|
||||
Edition: "",
|
||||
},
|
||||
}
|
||||
}
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -108,7 +108,7 @@ func ListUploadSessions(cfg *config.Config) *cli.Command {
|
||||
var fsStream events.Stream
|
||||
if cfg.Driver == "posix" {
|
||||
// We need to init the posix driver with 'scanfs' disabled
|
||||
drivers["posix"] = revaconfig.Posix(cfg, false)
|
||||
drivers["posix"] = revaconfig.Posix(cfg, false, false)
|
||||
// Also posix refuses to start without an events stream
|
||||
fsStream, err = event.NewStream(cfg)
|
||||
if err != nil {
|
||||
|
||||
@@ -123,7 +123,6 @@ func DefaultConfig() *config.Config {
|
||||
MaxConcurrency: 5,
|
||||
LockCycleDurationFactor: 30,
|
||||
DisableMultipart: true,
|
||||
AsyncUploads: true,
|
||||
},
|
||||
Decomposed: config.DecomposedDriver{
|
||||
Propagator: "sync",
|
||||
|
||||
@@ -85,7 +85,7 @@ func Local(cfg *config.Config) map[string]interface{} {
|
||||
}
|
||||
|
||||
// Posix is the config mapping for the Posix storage driver
|
||||
func Posix(cfg *config.Config, enableFSScan bool) map[string]interface{} {
|
||||
func Posix(cfg *config.Config, enableFSScan, enableFSWatch bool) map[string]interface{} {
|
||||
return map[string]interface{}{
|
||||
"root": cfg.Drivers.Posix.Root,
|
||||
"personalspacepath_template": cfg.Drivers.Posix.PersonalSpacePathTemplate,
|
||||
@@ -137,7 +137,7 @@ func Posix(cfg *config.Config, enableFSScan bool) map[string]interface{} {
|
||||
"use_space_groups": cfg.Drivers.Posix.UseSpaceGroups,
|
||||
"enable_fs_revisions": cfg.Drivers.Posix.EnableFSRevisions,
|
||||
"scan_fs": enableFSScan,
|
||||
"watch_fs": cfg.Drivers.Posix.WatchFS,
|
||||
"watch_fs": enableFSWatch,
|
||||
"watch_type": cfg.Drivers.Posix.WatchType,
|
||||
"watch_path": cfg.Drivers.Posix.WatchPath,
|
||||
"watch_folder_kafka_brokers": cfg.Drivers.Posix.WatchFolderKafkaBrokers,
|
||||
|
||||
@@ -16,7 +16,7 @@ func StorageProviderDrivers(cfg *config.Config) map[string]interface{} {
|
||||
"decomposed": DecomposedNoEvents(cfg),
|
||||
"s3": S3(cfg),
|
||||
"decomposeds3": DecomposedS3NoEvents(cfg),
|
||||
"posix": Posix(cfg, true),
|
||||
"posix": Posix(cfg, true, cfg.Drivers.Posix.WatchFS),
|
||||
|
||||
"ocis": Decomposed(cfg), // deprecated: use decomposed
|
||||
"s3ng": DecomposedS3NoEvents(cfg), // deprecated: use decomposeds3
|
||||
@@ -36,7 +36,7 @@ func DataProviderDrivers(cfg *config.Config) map[string]interface{} {
|
||||
"decomposed": Decomposed(cfg),
|
||||
"s3": S3(cfg),
|
||||
"decomposeds3": DecomposedS3(cfg),
|
||||
"posix": Posix(cfg, false),
|
||||
"posix": Posix(cfg, false, false),
|
||||
|
||||
"ocis": Decomposed(cfg), // deprecated: use decomposed
|
||||
"s3ng": DecomposedS3NoEvents(cfg), // deprecated: use decomposeds3
|
||||
|
||||
@@ -1,6 +1,6 @@
|
||||
SHELL := bash
|
||||
NAME := web
|
||||
WEB_ASSETS_VERSION = v2.1.1
|
||||
WEB_ASSETS_VERSION = v2.2.0
|
||||
WEB_ASSETS_BRANCH = main
|
||||
|
||||
ifneq (, $(shell command -v go 2> /dev/null)) # suppress `command not found warnings` for non go targets in CI
|
||||
|
||||
Binary file not shown.
|
Before Width: | Height: | Size: 15 KiB |
@@ -0,0 +1,3 @@
|
||||
<svg xmlns="http://www.w3.org/2000/svg" version="1.1" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:svgjs="http://svgjs.dev/svgjs" width="512" height="512"><svg id="SvgjsSvg1001" xmlns="http://www.w3.org/2000/svg" width="512" height="512" viewBox="0 0 512 512"><rect x=".02" y="0" width="512" height="512" fill="#20434f"></rect><polygon points="255.98 342.75 271.89 333.57 271.89 267.12 329.08 234.1 329.08 215.78 313.18 206.6 255.6 239.84 198.83 207.06 182.93 216.24 182.93 234.56 240.12 267.58 240.12 333.59 255.98 342.75" fill="#e2baff"></polygon><polygon points="401.95 150.82 256 66.56 256 66.56 256 66.56 110.05 150.82 110.05 187.5 256 103.24 401.95 187.5 401.95 150.82" fill="#e2baff"></polygon><polygon points="401.95 324.5 256 408.76 110.06 324.5 110.06 361.17 256 445.43 256 445.43 256 445.43 401.95 361.17 401.95 324.5" fill="#e2baff"></polygon></svg><style>@media (prefers-color-scheme: light) { :root { filter: none; } }
|
||||
@media (prefers-color-scheme: dark) { :root { filter: none; } }
|
||||
</style></svg>
|
||||
|
After Width: | Height: | Size: 1015 B |
@@ -43,7 +43,7 @@
|
||||
}
|
||||
},
|
||||
"logo": "themes/opencloud-dev/assets/logo.svg",
|
||||
"favicon": "themes/opencloud-dev/assets/favicon.jpg"
|
||||
"favicon": "themes/opencloud-dev/assets/favicon.svg"
|
||||
},
|
||||
"themes": [
|
||||
{
|
||||
|
||||
Binary file not shown.
|
Before Width: | Height: | Size: 15 KiB |
@@ -0,0 +1,3 @@
|
||||
<svg xmlns="http://www.w3.org/2000/svg" version="1.1" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:svgjs="http://svgjs.dev/svgjs" width="512" height="512"><svg id="SvgjsSvg1001" xmlns="http://www.w3.org/2000/svg" width="512" height="512" viewBox="0 0 512 512"><rect x=".02" y="0" width="512" height="512" fill="#20434f"></rect><polygon points="255.98 342.75 271.89 333.57 271.89 267.12 329.08 234.1 329.08 215.78 313.18 206.6 255.6 239.84 198.83 207.06 182.93 216.24 182.93 234.56 240.12 267.58 240.12 333.59 255.98 342.75" fill="#e2baff"></polygon><polygon points="401.95 150.82 256 66.56 256 66.56 256 66.56 110.05 150.82 110.05 187.5 256 103.24 401.95 187.5 401.95 150.82" fill="#e2baff"></polygon><polygon points="401.95 324.5 256 408.76 110.06 324.5 110.06 361.17 256 445.43 256 445.43 256 445.43 401.95 361.17 401.95 324.5" fill="#e2baff"></polygon></svg><style>@media (prefers-color-scheme: light) { :root { filter: none; } }
|
||||
@media (prefers-color-scheme: dark) { :root { filter: none; } }
|
||||
</style></svg>
|
||||
|
After Width: | Height: | Size: 1015 B |
@@ -50,7 +50,7 @@
|
||||
"web": {
|
||||
"defaults": {
|
||||
"logo": "themes/opencloud/assets/logo.svg",
|
||||
"favicon": "themes/opencloud/assets/favicon.ico",
|
||||
"favicon": "themes/opencloud/assets/favicon.svg",
|
||||
"designTokens": {
|
||||
"breakpoints": {
|
||||
"xsmall-max": "",
|
||||
@@ -94,9 +94,9 @@
|
||||
"label": "Light Theme",
|
||||
"designTokens": {
|
||||
"roles": {
|
||||
"primary": "#07677F",
|
||||
"primary": "#E2BAFF",
|
||||
"surfaceTint": "#07677F",
|
||||
"onPrimary": "#FFFFFF",
|
||||
"onPrimary": "#19353F",
|
||||
"primaryContainer": "#B7EAFF",
|
||||
"onPrimaryContainer": "#001F28",
|
||||
"secondary": "#20434f",
|
||||
@@ -147,17 +147,6 @@
|
||||
"onChrome": "#ffffff"
|
||||
},
|
||||
"colorPalette": {
|
||||
"background-accentuate": "rgba(255, 255, 5, 0.1)",
|
||||
"background-default": "#ffffff",
|
||||
"background-highlight": "#f1f3f4",
|
||||
"background-hover": "#f4e5ff",
|
||||
"background-muted": "#f8f8f8",
|
||||
"background-secondary": "#ffffff",
|
||||
"background-chrome": "#20434F",
|
||||
"background-sidebar": "#F1F3F4",
|
||||
"border": "#ecebee",
|
||||
"color-components-apptopbar-background": "transparent",
|
||||
"color-components-apptopbar-border": "#ceddee",
|
||||
"icon-archive": "#fbbe54",
|
||||
"icon-audio": "#700460",
|
||||
"icon-document": "#3b44a6",
|
||||
@@ -167,46 +156,7 @@
|
||||
"icon-pdf": "#ec0d47",
|
||||
"icon-presentation": "#ee6b3b",
|
||||
"icon-spreadsheet": "#15c286",
|
||||
"icon-video": "#045459",
|
||||
"input-bg": "#ffffff",
|
||||
"input-border": "#396676",
|
||||
"input-text-default": "#19353f",
|
||||
"input-text-muted": "#20434f",
|
||||
"swatch-brand-contrast": "#19353f",
|
||||
"swatch-brand-default": "#E2BAFF",
|
||||
"swatch-brand-hover": "#f4e5ff",
|
||||
"swatch-brand-muted": "#CA8DF5",
|
||||
"swatch-primary-contrast": "#ffffff",
|
||||
"swatch-primary-default": "#20434f",
|
||||
"swatch-primary-gradient": "#20434f",
|
||||
"swatch-primary-gradient-hover": "#20434f",
|
||||
"swatch-primary-hover": "#20434f",
|
||||
"swatch-primary-muted": "#20434f",
|
||||
"swatch-primary-muted-hover": "#20434f",
|
||||
"swatch-passive-contrast": "#ffffff",
|
||||
"swatch-passive-default": "#19353f",
|
||||
"swatch-passive-hover": "#19353f",
|
||||
"swatch-passive-hover-outline": "#ffffff",
|
||||
"swatch-passive-muted": "#19353f",
|
||||
"swatch-inverse-contrast": "#19353f",
|
||||
"swatch-inverse-default": "#ffffff",
|
||||
"swatch-inverse-hover": "#ffffff",
|
||||
"swatch-inverse-muted": "#dadada",
|
||||
"swatch-danger-contrast": "#ffffff",
|
||||
"swatch-danger-default": "#ba1a1a",
|
||||
"swatch-danger-hover": "#b12b2b",
|
||||
"swatch-danger-muted": "rgb(204, 117, 117)",
|
||||
"swatch-success-contrast": "#ffffff",
|
||||
"swatch-success-default": "rgb(3, 84, 63)",
|
||||
"swatch-success-hover": "#023b2c",
|
||||
"swatch-success-muted": "rgb(83, 150, 10)",
|
||||
"swatch-warning-contrast": "#ffffff",
|
||||
"swatch-warning-default": "rgb(183, 76, 27)",
|
||||
"swatch-warning-hover": "#a04318",
|
||||
"swatch-warning-muted": "rgba(183, 76, 27, .5)",
|
||||
"text-default": "#19353f",
|
||||
"text-inverse": "#ffffff",
|
||||
"text-muted": "#19353f"
|
||||
"icon-video": "#045459"
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
+3
-3
@@ -466,7 +466,7 @@ ANTIVIRUS_SCANNER_TYPE="clamav" \
|
||||
ANTIVIRUS_CLAMAV_SOCKET="tcp://host.docker.internal:3310" \
|
||||
POSTPROCESSING_STEPS="virusscan" \
|
||||
OC_ASYNC_UPLOADS=true \
|
||||
OC_ADD_RUN_SERVICES="antivirus"
|
||||
OC_ADD_RUN_SERVICES="antivirus" \
|
||||
opencloud/bin/opencloud server
|
||||
```
|
||||
|
||||
@@ -474,7 +474,7 @@ Note:
|
||||
The value for `ANTIVIRUS_CLAMAV_SOCKET` is an example which needs adaption according your OS.
|
||||
|
||||
For antivirus running localy on Linux OS, use `ANTIVIRUS_CLAMAV_SOCKET= "/var/run/clamav/clamd.ctl"`.
|
||||
For antivirus running localy on Mac OS, use `ANTIVIRUS_CLAMAV_SOCKET= "/tmp/clamd.socket"`.
|
||||
For antivirus running localy on Mac OS, use `ANTIVIRUS_CLAMAV_SOCKET= "/tmp/clamd.sock"`.
|
||||
For antivirus running with docker, use `ANTIVIRUS_CLAMAV_SOCKET= "tcp://host.docker.internal:3310"`
|
||||
|
||||
#### Run the Acceptance Test
|
||||
@@ -576,7 +576,7 @@ make -C opencloud dev-docker
|
||||
```
|
||||
|
||||
### Choose STORAGE_DRIVER
|
||||
By default, the system uses `decomposed` storage. However, you can override this by setting the `STORAGE_DRIVER` environment variable.
|
||||
By default, the system uses `posix` storage. However, you can override this by setting the `STORAGE_DRIVER` environment variable.
|
||||
|
||||
|
||||
### Run a script that starts the openCloud server in the docker and runs the API tests locally (for debugging purposes)
|
||||
|
||||
@@ -214,6 +214,11 @@ class CapabilitiesContext implements Context {
|
||||
$this->featureContext->theHTTPStatusCodeShouldBe(200, '', $response);
|
||||
|
||||
$responseXmlObject = HttpRequestHelper::getResponseXml($response, __METHOD__)->data->capabilities;
|
||||
$edition = $this->getParameterValueFromXml(
|
||||
$responseXmlObject,
|
||||
'core',
|
||||
'status@@@edition'
|
||||
);
|
||||
|
||||
$product = $this->getParameterValueFromXml(
|
||||
$responseXmlObject,
|
||||
@@ -238,6 +243,7 @@ class CapabilitiesContext implements Context {
|
||||
);
|
||||
}
|
||||
|
||||
$jsonExpectedDecoded['edition'] = $edition;
|
||||
$jsonExpectedDecoded['product'] = $product;
|
||||
$jsonExpectedDecoded['productname'] = $productName;
|
||||
|
||||
|
||||
@@ -2042,6 +2042,17 @@ class FeatureContext extends BehatVariablesContext {
|
||||
);
|
||||
}
|
||||
|
||||
/**
|
||||
* @return string
|
||||
*/
|
||||
public function getEditionFromStatus(): string {
|
||||
$decodedResponse = $this->getJsonDecodedStatusPhp();
|
||||
if (isset($decodedResponse['edition'])) {
|
||||
return $decodedResponse['edition'];
|
||||
}
|
||||
return '';
|
||||
}
|
||||
|
||||
/**
|
||||
* @return string|null
|
||||
*/
|
||||
@@ -2271,6 +2282,14 @@ class FeatureContext extends BehatVariablesContext {
|
||||
],
|
||||
"parameter" => []
|
||||
],
|
||||
[
|
||||
"code" => "%edition%",
|
||||
"function" => [
|
||||
$this,
|
||||
"getEditionFromStatus"
|
||||
],
|
||||
"parameter" => []
|
||||
],
|
||||
[
|
||||
"code" => "%version%",
|
||||
"function" => [
|
||||
|
||||
@@ -193,7 +193,6 @@
|
||||
- [apiServiceAvailability/serviceAvailabilityCheck.feature:125](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiServiceAvailability/serviceAvailabilityCheck.feature#L125)
|
||||
|
||||
#### [Skip tests for different languages](https://github.com/opencloud-eu/opencloud/issues/183)
|
||||
- [apiAntivirus/antivirus.feature:311](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiAntivirus/antivirus.feature#L311)
|
||||
- [apiActivities/activities.feature:2598](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiActivities/activities.feature#L2598)
|
||||
|
||||
|
||||
|
||||
@@ -308,7 +308,7 @@ Feature: antivirus
|
||||
| dav-path-version | language | subject | message |
|
||||
| old | es | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Virus: Eicar-Signature |
|
||||
| new | es | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Virus: Eicar-Signature |
|
||||
| spaces | es | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Eicar-Signature |
|
||||
| spaces | es | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Virus: Eicar-Signature |
|
||||
| old | de | Virus gefunden | In aFileWithVirus.txt wurde potenziell schädlicher Code gefunden. Das Hochladen wurde abgebrochen. Grund: Eicar-Signature |
|
||||
| new | de | Virus gefunden | In aFileWithVirus.txt wurde potenziell schädlicher Code gefunden. Das Hochladen wurde abgebrochen. Grund: Eicar-Signature |
|
||||
| spaces | de | Virus gefunden | In aFileWithVirus.txt wurde potenziell schädlicher Code gefunden. Das Hochladen wurde abgebrochen. Grund: Eicar-Signature |
|
||||
|
||||
@@ -193,12 +193,17 @@ Feature: capabilities
|
||||
"status": {
|
||||
"type": "object",
|
||||
"required": [
|
||||
"edition",
|
||||
"product",
|
||||
"productname",
|
||||
"version",
|
||||
"versionstring"
|
||||
],
|
||||
"properties": {
|
||||
"edition": {
|
||||
"type": "string",
|
||||
"enum": ["%edition%"]
|
||||
},
|
||||
"product": {
|
||||
"type": "string",
|
||||
"enum": ["%productname%"]
|
||||
@@ -225,6 +230,7 @@ Feature: capabilities
|
||||
"type": "object",
|
||||
"required": [
|
||||
"string",
|
||||
"edition",
|
||||
"product"
|
||||
],
|
||||
"properties": {
|
||||
@@ -232,6 +238,10 @@ Feature: capabilities
|
||||
"type": "string",
|
||||
"enum": ["%versionstring%"]
|
||||
},
|
||||
"edition": {
|
||||
"type": "string",
|
||||
"enum": ["%edition%"]
|
||||
},
|
||||
"product": {
|
||||
"type": "string",
|
||||
"enum": ["%productname%"]
|
||||
|
||||
@@ -47,6 +47,7 @@ Feature: default capabilities for normal user
|
||||
"required": [
|
||||
"version",
|
||||
"versionstring",
|
||||
"edition",
|
||||
"productname"
|
||||
],
|
||||
"properties": {
|
||||
@@ -56,6 +57,9 @@ Feature: default capabilities for normal user
|
||||
"versionstring": {
|
||||
"const": "%versionstring%"
|
||||
},
|
||||
"edition": {
|
||||
"const": "%edition%"
|
||||
},
|
||||
"productname": {
|
||||
"const": "%productname%"
|
||||
}
|
||||
|
||||
@@ -8,5 +8,5 @@ Feature: Status
|
||||
When the administrator requests status.php
|
||||
Then the status.php response should include
|
||||
"""
|
||||
{"installed":true,"maintenance":false,"needsDbUpgrade":false,"version":"$CURRENT_VERSION","versionstring":"$CURRENT_VERSION_STRING","productname":"$PRODUCTNAME","product":"$PRODUCT"}
|
||||
{"installed":true,"maintenance":false,"needsDbUpgrade":false,"version":"$CURRENT_VERSION","versionstring":"$CURRENT_VERSION_STRING","edition":"$EDITION","productname":"$PRODUCTNAME","product":"$PRODUCT"}
|
||||
"""
|
||||
@@ -4,7 +4,7 @@
|
||||
export LOCAL_TEST=true
|
||||
export START_EMAIL=true
|
||||
export WITH_WRAPPER=true
|
||||
export STORAGE_DRIVER=${STORAGE_DRIVER:-decomposed}
|
||||
export STORAGE_DRIVER=${STORAGE_DRIVER:-posix}
|
||||
export TEST_ROOT_PATH="/drone/src/tests"
|
||||
|
||||
# LOCAL TEST WITHOUT EXTRA ENVS
|
||||
|
||||
@@ -7,15 +7,13 @@
|
||||
|
||||
ROOT_PATH="$1"
|
||||
if [ -z "$1" ]; then
|
||||
ROOT_PATH="/drone/src"
|
||||
ROOT_PATH="/woodpecker/src/github.com/opencloud-eu/opencloud"
|
||||
fi
|
||||
BINGO_DIR="$ROOT_PATH/.bingo"
|
||||
|
||||
# generate hash of a .bingo folder
|
||||
BINGO_HASH=$(cat "$BINGO_DIR"/* | sha256sum | cut -d ' ' -f 1)
|
||||
|
||||
URL="$CACHE_ENDPOINT/$CACHE_BUCKET/opencloud/go-bin/$BINGO_HASH/$2"
|
||||
|
||||
mc alias set s3 "$MC_HOST" "$AWS_ACCESS_KEY_ID" "$AWS_SECRET_ACCESS_KEY"
|
||||
|
||||
if mc ls --json s3/"$CACHE_BUCKET"/opencloud/go-bin/"$BINGO_HASH"/$2 | grep "\"status\":\"success\""; then
|
||||
|
||||
+102
@@ -0,0 +1,102 @@
|
||||
version: "2"
|
||||
linters:
|
||||
default: all
|
||||
disable:
|
||||
- asasalint
|
||||
- asciicheck
|
||||
- bidichk
|
||||
- bodyclose
|
||||
- canonicalheader
|
||||
- containedctx
|
||||
- contextcheck
|
||||
- copyloopvar
|
||||
- cyclop
|
||||
- decorder
|
||||
- depguard
|
||||
- dogsled
|
||||
- dupl
|
||||
- dupword
|
||||
- durationcheck
|
||||
- err113
|
||||
- errcheck
|
||||
- errchkjson
|
||||
- errname
|
||||
- errorlint
|
||||
- exhaustive
|
||||
- exhaustruct
|
||||
- exptostd
|
||||
- fatcontext
|
||||
- forbidigo
|
||||
- forcetypeassert
|
||||
- funlen
|
||||
- ginkgolinter
|
||||
- gocheckcompilerdirectives
|
||||
- gochecknoglobals
|
||||
- gochecknoinits
|
||||
- gochecksumtype
|
||||
- gocognit
|
||||
- goconst
|
||||
- gocritic
|
||||
- gocyclo
|
||||
- godot
|
||||
- godox
|
||||
- goheader
|
||||
- gomoddirectives
|
||||
- gomodguard
|
||||
- goprintffuncname
|
||||
- gosec
|
||||
- gosmopolitan
|
||||
- govet
|
||||
- grouper
|
||||
- iface
|
||||
- importas
|
||||
- inamedparam
|
||||
- ineffassign
|
||||
- interfacebloat
|
||||
- intrange
|
||||
- ireturn
|
||||
- lll
|
||||
- loggercheck
|
||||
- maintidx
|
||||
- makezero
|
||||
- mirror
|
||||
- misspell
|
||||
- mnd
|
||||
- musttag
|
||||
- nakedret
|
||||
- nestif
|
||||
- nilerr
|
||||
- nilnesserr
|
||||
- nilnil
|
||||
- nlreturn
|
||||
- noctx
|
||||
- nolintlint
|
||||
- nonamedreturns
|
||||
- nosprintfhostport
|
||||
- paralleltest
|
||||
- perfsprint
|
||||
- prealloc
|
||||
- predeclared
|
||||
- promlinter
|
||||
- protogetter
|
||||
- reassign
|
||||
- recvcheck
|
||||
- revive
|
||||
- rowserrcheck
|
||||
- sloglint
|
||||
- spancheck
|
||||
- sqlclosecheck
|
||||
- staticcheck
|
||||
- tagalign
|
||||
- tagliatelle
|
||||
- testableexamples
|
||||
- testifylint
|
||||
- testpackage
|
||||
- thelper
|
||||
- tparallel
|
||||
- unparam
|
||||
- varnamelen
|
||||
- whitespace
|
||||
- wrapcheck
|
||||
- wsl
|
||||
- zerologlint
|
||||
+1
-1
@@ -3,7 +3,7 @@ GOCMD=go
|
||||
linters-install:
|
||||
@golangci-lint --version >/dev/null 2>&1 || { \
|
||||
echo "installing linting tools..."; \
|
||||
curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v1.41.1; \
|
||||
curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v2.0.2; \
|
||||
}
|
||||
|
||||
lint: linters-install
|
||||
|
||||
+2
-2
@@ -1,7 +1,6 @@
|
||||
Package validator
|
||||
=================
|
||||
<img align="right" src="logo.png">[](https://gitter.im/go-playground/validator?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge)
|
||||

|
||||
<img align="right" src="logo.png">
|
||||
[](https://github.com/go-playground/validator/actions)
|
||||
[](https://coveralls.io/github/go-playground/validator?branch=master)
|
||||
[](https://goreportcard.com/report/github.com/go-playground/validator)
|
||||
@@ -173,6 +172,7 @@ validate := validator.New(validator.WithRequiredStructEnabled())
|
||||
| spicedb | SpiceDb ObjectID/Permission/Type |
|
||||
| datetime | Datetime |
|
||||
| e164 | e164 formatted phone number |
|
||||
| ein | U.S. Employeer Identification Number |
|
||||
| email | E-mail String
|
||||
| eth_addr | Ethereum Address |
|
||||
| hexadecimal | Hexadecimal String |
|
||||
|
||||
+27
-8
@@ -9,6 +9,7 @@ import (
|
||||
"fmt"
|
||||
"io/fs"
|
||||
"net"
|
||||
"net/mail"
|
||||
"net/url"
|
||||
"os"
|
||||
"reflect"
|
||||
@@ -242,6 +243,7 @@ var (
|
||||
"mongodb_connection_string": isMongoDBConnectionString,
|
||||
"cron": isCron,
|
||||
"spicedb": isSpiceDB,
|
||||
"ein": isEIN,
|
||||
}
|
||||
)
|
||||
|
||||
@@ -258,7 +260,7 @@ func parseOneOfParam2(s string) []string {
|
||||
oneofValsCacheRWLock.Lock()
|
||||
vals = splitParamsRegex().FindAllString(s, -1)
|
||||
for i := 0; i < len(vals); i++ {
|
||||
vals[i] = strings.Replace(vals[i], "'", "", -1)
|
||||
vals[i] = strings.ReplaceAll(vals[i], "'", "")
|
||||
}
|
||||
oneofValsCache[s] = vals
|
||||
oneofValsCacheRWLock.Unlock()
|
||||
@@ -1376,7 +1378,6 @@ func isEqIgnoreCase(fl FieldLevel) bool {
|
||||
param := fl.Param()
|
||||
|
||||
switch field.Kind() {
|
||||
|
||||
case reflect.String:
|
||||
return strings.EqualFold(field.String(), param)
|
||||
}
|
||||
@@ -1606,7 +1607,6 @@ func isImage(fl FieldLevel) bool {
|
||||
case reflect.String:
|
||||
filePath := field.String()
|
||||
fileInfo, err := os.Stat(filePath)
|
||||
|
||||
if err != nil {
|
||||
return false
|
||||
}
|
||||
@@ -1619,7 +1619,9 @@ func isImage(fl FieldLevel) bool {
|
||||
if err != nil {
|
||||
return false
|
||||
}
|
||||
defer file.Close()
|
||||
defer func() {
|
||||
_ = file.Close()
|
||||
}()
|
||||
|
||||
mime, err := mimetype.DetectReader(file)
|
||||
if err != nil {
|
||||
@@ -1635,7 +1637,6 @@ func isImage(fl FieldLevel) bool {
|
||||
|
||||
// isFilePath is the validation function for validating if the current field's value is a valid file path.
|
||||
func isFilePath(fl FieldLevel) bool {
|
||||
|
||||
var exists bool
|
||||
var err error
|
||||
|
||||
@@ -1695,6 +1696,10 @@ func isE164(fl FieldLevel) bool {
|
||||
|
||||
// isEmail is the validation function for validating if the current field's value is a valid email address.
|
||||
func isEmail(fl FieldLevel) bool {
|
||||
_, err := mail.ParseAddress(fl.Field().String())
|
||||
if err != nil {
|
||||
return false
|
||||
}
|
||||
return emailRegex().MatchString(fl.Field().String())
|
||||
}
|
||||
|
||||
@@ -2227,7 +2232,6 @@ func isGt(fl FieldLevel) bool {
|
||||
case reflect.Struct:
|
||||
|
||||
if field.Type().ConvertibleTo(timeType) {
|
||||
|
||||
return field.Convert(timeType).Interface().(time.Time).After(time.Now().UTC())
|
||||
}
|
||||
}
|
||||
@@ -2464,7 +2468,6 @@ func isLt(fl FieldLevel) bool {
|
||||
case reflect.Struct:
|
||||
|
||||
if field.Type().ConvertibleTo(timeType) {
|
||||
|
||||
return field.Convert(timeType).Interface().(time.Time).Before(time.Now().UTC())
|
||||
}
|
||||
}
|
||||
@@ -2644,7 +2647,6 @@ func isDir(fl FieldLevel) bool {
|
||||
|
||||
// isDirPath is the validation function for validating if the current field's value is a valid directory.
|
||||
func isDirPath(fl FieldLevel) bool {
|
||||
|
||||
var exists bool
|
||||
var err error
|
||||
|
||||
@@ -2957,6 +2959,12 @@ func isCveFormat(fl FieldLevel) bool {
|
||||
// a valid dns RFC 1035 label, defined in RFC 1035.
|
||||
func isDnsRFC1035LabelFormat(fl FieldLevel) bool {
|
||||
val := fl.Field().String()
|
||||
|
||||
size := len(val)
|
||||
if size > 63 {
|
||||
return false
|
||||
}
|
||||
|
||||
return dnsRegexRFC1035Label().MatchString(val)
|
||||
}
|
||||
|
||||
@@ -3060,3 +3068,14 @@ func isCron(fl FieldLevel) bool {
|
||||
cronString := fl.Field().String()
|
||||
return cronRegex().MatchString(cronString)
|
||||
}
|
||||
|
||||
// isEIN is the validation function for validating if the current field's value is a valid U.S. Employer Identification Number (EIN)
|
||||
func isEIN(fl FieldLevel) bool {
|
||||
field := fl.Field()
|
||||
|
||||
if field.Len() != 10 {
|
||||
return false
|
||||
}
|
||||
|
||||
return einRegex().MatchString(field.String())
|
||||
}
|
||||
+1
-1
@@ -309,7 +309,7 @@ func (v *Validate) parseFieldTagsRecursive(tag string, fieldName string, alias s
|
||||
}
|
||||
|
||||
if len(vals) > 1 {
|
||||
current.param = strings.Replace(strings.Replace(vals[1], utf8HexComma, ",", -1), utf8Pipe, "|", -1)
|
||||
current.param = strings.ReplaceAll(strings.ReplaceAll(vals[1], utf8HexComma, ","), utf8Pipe, "|")
|
||||
}
|
||||
}
|
||||
current.isBlockEnd = true
|
||||
|
||||
+7
-1
@@ -959,7 +959,7 @@ Although an empty string is a valid base64 URL safe value, this will report
|
||||
an empty string as an error, if you wish to accept an empty string as valid
|
||||
you can use this with the omitempty tag.
|
||||
|
||||
Usage: base64url
|
||||
Usage: base64rawurl
|
||||
|
||||
# Bitcoin Address
|
||||
|
||||
@@ -1134,6 +1134,12 @@ This validates that a string value contains a valid longitude.
|
||||
|
||||
Usage: longitude
|
||||
|
||||
# Employeer Identification Number EIN
|
||||
|
||||
This validates that a string value contains a valid U.S. Employer Identification Number.
|
||||
|
||||
Usage: ein
|
||||
|
||||
# Social Security Number SSN
|
||||
|
||||
This validates that a string value contains a valid U.S. Social Security Number.
|
||||
|
||||
+3
-1
@@ -69,7 +69,7 @@ const (
|
||||
splitParamsRegexString = `'[^']*'|\S+`
|
||||
bicRegexString = `^[A-Za-z]{6}[A-Za-z0-9]{2}([A-Za-z0-9]{3})?$`
|
||||
semverRegexString = `^(0|[1-9]\d*)\.(0|[1-9]\d*)\.(0|[1-9]\d*)(?:-((?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*)(?:\.(?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*))*))?(?:\+([0-9a-zA-Z-]+(?:\.[0-9a-zA-Z-]+)*))?$` // numbered capture groups https://semver.org/
|
||||
dnsRegexStringRFC1035Label = "^[a-z]([-a-z0-9]*[a-z0-9]){0,62}$"
|
||||
dnsRegexStringRFC1035Label = "^[a-z]([-a-z0-9]*[a-z0-9])?$"
|
||||
cveRegexString = `^CVE-(1999|2\d{3})-(0[^0]\d{2}|0\d[^0]\d{1}|0\d{2}[^0]|[1-9]{1}\d{3,})$` // CVE Format Id https://cve.mitre.org/cve/identifiers/syntaxchange.html
|
||||
mongodbIdRegexString = "^[a-f\\d]{24}$"
|
||||
mongodbConnStringRegexString = "^mongodb(\\+srv)?:\\/\\/(([a-zA-Z\\d]+):([a-zA-Z\\d$:\\/?#\\[\\]@]+)@)?(([a-z\\d.-]+)(:[\\d]+)?)((,(([a-z\\d.-]+)(:(\\d+))?))*)?(\\/[a-zA-Z-_]{1,64})?(\\?(([a-zA-Z]+)=([a-zA-Z\\d]+))(&(([a-zA-Z\\d]+)=([a-zA-Z\\d]+))?)*)?$"
|
||||
@@ -77,6 +77,7 @@ const (
|
||||
spicedbIDRegexString = `^(([a-zA-Z0-9/_|\-=+]{1,})|\*)$`
|
||||
spicedbPermissionRegexString = "^([a-z][a-z0-9_]{1,62}[a-z0-9])?$"
|
||||
spicedbTypeRegexString = "^([a-z][a-z0-9_]{1,61}[a-z0-9]/)?[a-z][a-z0-9_]{1,62}[a-z0-9]$"
|
||||
einRegexString = "^(\\d{2}-\\d{7})$"
|
||||
)
|
||||
|
||||
func lazyRegexCompile(str string) func() *regexp.Regexp {
|
||||
@@ -160,4 +161,5 @@ var (
|
||||
spicedbIDRegex = lazyRegexCompile(spicedbIDRegexString)
|
||||
spicedbPermissionRegex = lazyRegexCompile(spicedbPermissionRegexString)
|
||||
spicedbTypeRegex = lazyRegexCompile(spicedbTypeRegexString)
|
||||
einRegex = lazyRegexCompile(einRegexString)
|
||||
)
|
||||
+3
-3
@@ -46,9 +46,9 @@ type StructLevel interface {
|
||||
//
|
||||
// NOTES:
|
||||
//
|
||||
// fieldName and altName get appended to the existing namespace that
|
||||
// validator is on. e.g. pass 'FirstName' or 'Names[0]' depending
|
||||
// on the nesting
|
||||
// fieldName and structFieldName get appended to the existing
|
||||
// namespace that validator is on. e.g. pass 'FirstName' or
|
||||
// 'Names[0]' depending on the nesting
|
||||
//
|
||||
// tag can be an existing validation tag or just something you make up
|
||||
// and process on the flip side it's up to you.
|
||||
|
||||
+56
-14
@@ -217,17 +217,18 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
customTransFunc: func(ut ut.Translator, fe validator.FieldError) string {
|
||||
var err error
|
||||
var t string
|
||||
|
||||
var f64 float64
|
||||
var digits uint64
|
||||
var kind reflect.Kind
|
||||
|
||||
if idx := strings.Index(fe.Param(), "."); idx != -1 {
|
||||
digits = uint64(len(fe.Param()[idx+1:]))
|
||||
}
|
||||
fn := func() (err error) {
|
||||
if idx := strings.Index(fe.Param(), "."); idx != -1 {
|
||||
digits = uint64(len(fe.Param()[idx+1:]))
|
||||
}
|
||||
|
||||
f64, err := strconv.ParseFloat(fe.Param(), 64)
|
||||
if err != nil {
|
||||
goto END
|
||||
f64, err = strconv.ParseFloat(fe.Param(), 64)
|
||||
|
||||
return
|
||||
}
|
||||
|
||||
kind = fe.Kind()
|
||||
@@ -240,6 +241,11 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
|
||||
var c string
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
c, err = ut.C("min-string-character", f64, digits, ut.FmtNumber(f64, digits))
|
||||
if err != nil {
|
||||
goto END
|
||||
@@ -250,6 +256,11 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
case reflect.Slice, reflect.Map, reflect.Array:
|
||||
var c string
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
c, err = ut.C("min-items-item", f64, digits, ut.FmtNumber(f64, digits))
|
||||
if err != nil {
|
||||
goto END
|
||||
@@ -258,6 +269,16 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
t, err = ut.T("min-items", fe.Field(), c)
|
||||
|
||||
default:
|
||||
if fe.Type() == reflect.TypeOf(time.Duration(0)) {
|
||||
t, err = ut.T("min-number", fe.Field(), fe.Param())
|
||||
goto END
|
||||
}
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
t, err = ut.T("min-number", fe.Field(), ut.FmtNumber(f64, digits))
|
||||
}
|
||||
|
||||
@@ -305,17 +326,18 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
customTransFunc: func(ut ut.Translator, fe validator.FieldError) string {
|
||||
var err error
|
||||
var t string
|
||||
|
||||
var f64 float64
|
||||
var digits uint64
|
||||
var kind reflect.Kind
|
||||
|
||||
if idx := strings.Index(fe.Param(), "."); idx != -1 {
|
||||
digits = uint64(len(fe.Param()[idx+1:]))
|
||||
}
|
||||
fn := func() (err error) {
|
||||
if idx := strings.Index(fe.Param(), "."); idx != -1 {
|
||||
digits = uint64(len(fe.Param()[idx+1:]))
|
||||
}
|
||||
|
||||
f64, err := strconv.ParseFloat(fe.Param(), 64)
|
||||
if err != nil {
|
||||
goto END
|
||||
f64, err = strconv.ParseFloat(fe.Param(), 64)
|
||||
|
||||
return
|
||||
}
|
||||
|
||||
kind = fe.Kind()
|
||||
@@ -328,6 +350,11 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
|
||||
var c string
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
c, err = ut.C("max-string-character", f64, digits, ut.FmtNumber(f64, digits))
|
||||
if err != nil {
|
||||
goto END
|
||||
@@ -338,6 +365,11 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
case reflect.Slice, reflect.Map, reflect.Array:
|
||||
var c string
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
c, err = ut.C("max-items-item", f64, digits, ut.FmtNumber(f64, digits))
|
||||
if err != nil {
|
||||
goto END
|
||||
@@ -346,6 +378,16 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
t, err = ut.T("max-items", fe.Field(), c)
|
||||
|
||||
default:
|
||||
if fe.Type() == reflect.TypeOf(time.Duration(0)) {
|
||||
t, err = ut.T("max-number", fe.Field(), fe.Param())
|
||||
goto END
|
||||
}
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
t, err = ut.T("max-number", fe.Field(), ut.FmtNumber(f64, digits))
|
||||
}
|
||||
|
||||
|
||||
+3
-20
@@ -1,5 +1,4 @@
|
||||
# This is an example goreleaser.yaml file with some sane defaults.
|
||||
# Make sure to check the documentation at http://goreleaser.com
|
||||
version: 2
|
||||
|
||||
builds:
|
||||
-
|
||||
@@ -27,16 +26,7 @@ builds:
|
||||
archives:
|
||||
-
|
||||
id: cpuid
|
||||
name_template: "cpuid-{{ .Os }}_{{ .Arch }}_{{ .Version }}"
|
||||
replacements:
|
||||
aix: AIX
|
||||
darwin: OSX
|
||||
linux: Linux
|
||||
windows: Windows
|
||||
386: i386
|
||||
amd64: x86_64
|
||||
freebsd: FreeBSD
|
||||
netbsd: NetBSD
|
||||
name_template: "cpuid-{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
|
||||
format_overrides:
|
||||
- goos: windows
|
||||
format: zip
|
||||
@@ -44,8 +34,6 @@ archives:
|
||||
- LICENSE
|
||||
checksum:
|
||||
name_template: 'checksums.txt'
|
||||
snapshot:
|
||||
name_template: "{{ .Tag }}-next"
|
||||
changelog:
|
||||
sort: asc
|
||||
filters:
|
||||
@@ -58,7 +46,7 @@ changelog:
|
||||
|
||||
nfpms:
|
||||
-
|
||||
file_name_template: "cpuid_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}"
|
||||
file_name_template: "cpuid_package_{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
|
||||
vendor: Klaus Post
|
||||
homepage: https://github.com/klauspost/cpuid
|
||||
maintainer: Klaus Post <klauspost@gmail.com>
|
||||
@@ -67,8 +55,3 @@ nfpms:
|
||||
formats:
|
||||
- deb
|
||||
- rpm
|
||||
replacements:
|
||||
darwin: Darwin
|
||||
linux: Linux
|
||||
freebsd: FreeBSD
|
||||
amd64: x86_64
|
||||
+6
@@ -282,7 +282,9 @@ Exit Code 1
|
||||
| AMXINT8 | Tile computational operations on 8-bit integers |
|
||||
| AMXFP16 | Tile computational operations on FP16 numbers |
|
||||
| AMXFP8 | Tile computational operations on FP8 numbers |
|
||||
| AMXCOMPLEX | Tile computational operations on complex numbers |
|
||||
| AMXTILE | Tile architecture |
|
||||
| AMXTF32 | Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile |
|
||||
| APX_F | Intel APX |
|
||||
| AVX | AVX functions |
|
||||
| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported |
|
||||
@@ -480,12 +482,16 @@ Exit Code 1
|
||||
| DCPOP | Data cache clean to Point of Persistence (DC CVAP) |
|
||||
| EVTSTRM | Generic timer |
|
||||
| FCMA | Floatin point complex number addition and multiplication |
|
||||
| FHM | FMLAL and FMLSL instructions |
|
||||
| FP | Single-precision and double-precision floating point |
|
||||
| FPHP | Half-precision floating point |
|
||||
| GPA | Generic Pointer Authentication |
|
||||
| JSCVT | Javascript-style double->int convert (FJCVTZS) |
|
||||
| LRCPC | Weaker release consistency (LDAPR, etc) |
|
||||
| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) |
|
||||
| RNDR | Random Number instructions |
|
||||
| TLB | Outer Shareable and TLB range maintenance instructions |
|
||||
| TS | Flag manipulation instructions |
|
||||
| SHA1 | SHA-1 instructions (SHA1C, etc) |
|
||||
| SHA2 | SHA-2 instructions (SHA256H, etc) |
|
||||
| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) |
|
||||
|
||||
+9
-1
@@ -83,6 +83,8 @@ const (
|
||||
AMXINT8 // Tile computational operations on 8-bit integers
|
||||
AMXFP8 // Tile computational operations on FP8 numbers
|
||||
AMXTILE // Tile architecture
|
||||
AMXTF32 // Tile architecture
|
||||
AMXCOMPLEX // Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile
|
||||
APX_F // Intel APX
|
||||
AVX // AVX functions
|
||||
AVX10 // If set the Intel AVX10 Converged Vector ISA is supported
|
||||
@@ -282,12 +284,16 @@ const (
|
||||
DCPOP // Data cache clean to Point of Persistence (DC CVAP)
|
||||
EVTSTRM // Generic timer
|
||||
FCMA // Floatin point complex number addition and multiplication
|
||||
FHM // FMLAL and FMLSL instructions
|
||||
FP // Single-precision and double-precision floating point
|
||||
FPHP // Half-precision floating point
|
||||
GPA // Generic Pointer Authentication
|
||||
JSCVT // Javascript-style double->int convert (FJCVTZS)
|
||||
LRCPC // Weaker release consistency (LDAPR, etc)
|
||||
PMULL // Polynomial Multiply instructions (PMULL/PMULL2)
|
||||
RNDR // Random Number instructions
|
||||
TLB // Outer Shareable and TLB range maintenance instructions
|
||||
TS // Flag manipulation instructions
|
||||
SHA1 // SHA-1 instructions (SHA1C, etc)
|
||||
SHA2 // SHA-2 instructions (SHA256H, etc)
|
||||
SHA3 // SHA-3 instructions (EOR3, RAXI, XAR, BCAX)
|
||||
@@ -532,7 +538,7 @@ func (c CPUInfo) Ia32TscAux() uint32 {
|
||||
return ecx
|
||||
}
|
||||
|
||||
// SveLengths returns arm SVE vector and predicate lengths.
|
||||
// SveLengths returns arm SVE vector and predicate lengths in bits.
|
||||
// Will return 0, 0 if SVE is not enabled or otherwise unable to detect.
|
||||
func (c CPUInfo) SveLengths() (vl, pl uint64) {
|
||||
if !c.Has(SVE) {
|
||||
@@ -1284,6 +1290,8 @@ func support() flagSet {
|
||||
// CPUID.(EAX=7, ECX=1).EDX
|
||||
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
|
||||
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
|
||||
fs.setIf(edx1&(1<<7) != 0, AMXTF32)
|
||||
fs.setIf(edx1&(1<<8) != 0, AMXCOMPLEX)
|
||||
fs.setIf(edx1&(1<<10) != 0, AVXVNNIINT16)
|
||||
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
|
||||
fs.setIf(edx1&(1<<19) != 0, AVX10)
|
||||
|
||||
+8
-6
@@ -157,6 +157,10 @@ func addInfo(c *CPUInfo, safe bool) {
|
||||
// x--------------------------------------------------x
|
||||
// | Name | bits | visible |
|
||||
// |--------------------------------------------------|
|
||||
// | RNDR | [63-60] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | TLB | [59-56] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | TS | [55-52] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | FHM | [51-48] | y |
|
||||
@@ -182,12 +186,10 @@ func addInfo(c *CPUInfo, safe bool) {
|
||||
// | AES | [7-4] | y |
|
||||
// x--------------------------------------------------x
|
||||
|
||||
// if instAttrReg0&(0xf<<52) != 0 {
|
||||
// fmt.Println("TS")
|
||||
// }
|
||||
// if instAttrReg0&(0xf<<48) != 0 {
|
||||
// fmt.Println("FHM")
|
||||
// }
|
||||
f.setIf(instAttrReg0&(0xf<<60) != 0, RNDR)
|
||||
f.setIf(instAttrReg0&(0xf<<56) != 0, TLB)
|
||||
f.setIf(instAttrReg0&(0xf<<52) != 0, TS)
|
||||
f.setIf(instAttrReg0&(0xf<<48) != 0, FHM)
|
||||
f.setIf(instAttrReg0&(0xf<<44) != 0, ASIMDDP)
|
||||
f.setIf(instAttrReg0&(0xf<<40) != 0, SM4)
|
||||
f.setIf(instAttrReg0&(0xf<<36) != 0, SM3)
|
||||
|
||||
+219
-213
@@ -17,223 +17,229 @@ func _() {
|
||||
_ = x[AMXINT8-7]
|
||||
_ = x[AMXFP8-8]
|
||||
_ = x[AMXTILE-9]
|
||||
_ = x[APX_F-10]
|
||||
_ = x[AVX-11]
|
||||
_ = x[AVX10-12]
|
||||
_ = x[AVX10_128-13]
|
||||
_ = x[AVX10_256-14]
|
||||
_ = x[AVX10_512-15]
|
||||
_ = x[AVX2-16]
|
||||
_ = x[AVX512BF16-17]
|
||||
_ = x[AVX512BITALG-18]
|
||||
_ = x[AVX512BW-19]
|
||||
_ = x[AVX512CD-20]
|
||||
_ = x[AVX512DQ-21]
|
||||
_ = x[AVX512ER-22]
|
||||
_ = x[AVX512F-23]
|
||||
_ = x[AVX512FP16-24]
|
||||
_ = x[AVX512IFMA-25]
|
||||
_ = x[AVX512PF-26]
|
||||
_ = x[AVX512VBMI-27]
|
||||
_ = x[AVX512VBMI2-28]
|
||||
_ = x[AVX512VL-29]
|
||||
_ = x[AVX512VNNI-30]
|
||||
_ = x[AVX512VP2INTERSECT-31]
|
||||
_ = x[AVX512VPOPCNTDQ-32]
|
||||
_ = x[AVXIFMA-33]
|
||||
_ = x[AVXNECONVERT-34]
|
||||
_ = x[AVXSLOW-35]
|
||||
_ = x[AVXVNNI-36]
|
||||
_ = x[AVXVNNIINT8-37]
|
||||
_ = x[AVXVNNIINT16-38]
|
||||
_ = x[BHI_CTRL-39]
|
||||
_ = x[BMI1-40]
|
||||
_ = x[BMI2-41]
|
||||
_ = x[CETIBT-42]
|
||||
_ = x[CETSS-43]
|
||||
_ = x[CLDEMOTE-44]
|
||||
_ = x[CLMUL-45]
|
||||
_ = x[CLZERO-46]
|
||||
_ = x[CMOV-47]
|
||||
_ = x[CMPCCXADD-48]
|
||||
_ = x[CMPSB_SCADBS_SHORT-49]
|
||||
_ = x[CMPXCHG8-50]
|
||||
_ = x[CPBOOST-51]
|
||||
_ = x[CPPC-52]
|
||||
_ = x[CX16-53]
|
||||
_ = x[EFER_LMSLE_UNS-54]
|
||||
_ = x[ENQCMD-55]
|
||||
_ = x[ERMS-56]
|
||||
_ = x[F16C-57]
|
||||
_ = x[FLUSH_L1D-58]
|
||||
_ = x[FMA3-59]
|
||||
_ = x[FMA4-60]
|
||||
_ = x[FP128-61]
|
||||
_ = x[FP256-62]
|
||||
_ = x[FSRM-63]
|
||||
_ = x[FXSR-64]
|
||||
_ = x[FXSROPT-65]
|
||||
_ = x[GFNI-66]
|
||||
_ = x[HLE-67]
|
||||
_ = x[HRESET-68]
|
||||
_ = x[HTT-69]
|
||||
_ = x[HWA-70]
|
||||
_ = x[HYBRID_CPU-71]
|
||||
_ = x[HYPERVISOR-72]
|
||||
_ = x[IA32_ARCH_CAP-73]
|
||||
_ = x[IA32_CORE_CAP-74]
|
||||
_ = x[IBPB-75]
|
||||
_ = x[IBPB_BRTYPE-76]
|
||||
_ = x[IBRS-77]
|
||||
_ = x[IBRS_PREFERRED-78]
|
||||
_ = x[IBRS_PROVIDES_SMP-79]
|
||||
_ = x[IBS-80]
|
||||
_ = x[IBSBRNTRGT-81]
|
||||
_ = x[IBSFETCHSAM-82]
|
||||
_ = x[IBSFFV-83]
|
||||
_ = x[IBSOPCNT-84]
|
||||
_ = x[IBSOPCNTEXT-85]
|
||||
_ = x[IBSOPSAM-86]
|
||||
_ = x[IBSRDWROPCNT-87]
|
||||
_ = x[IBSRIPINVALIDCHK-88]
|
||||
_ = x[IBS_FETCH_CTLX-89]
|
||||
_ = x[IBS_OPDATA4-90]
|
||||
_ = x[IBS_OPFUSE-91]
|
||||
_ = x[IBS_PREVENTHOST-92]
|
||||
_ = x[IBS_ZEN4-93]
|
||||
_ = x[IDPRED_CTRL-94]
|
||||
_ = x[INT_WBINVD-95]
|
||||
_ = x[INVLPGB-96]
|
||||
_ = x[KEYLOCKER-97]
|
||||
_ = x[KEYLOCKERW-98]
|
||||
_ = x[LAHF-99]
|
||||
_ = x[LAM-100]
|
||||
_ = x[LBRVIRT-101]
|
||||
_ = x[LZCNT-102]
|
||||
_ = x[MCAOVERFLOW-103]
|
||||
_ = x[MCDT_NO-104]
|
||||
_ = x[MCOMMIT-105]
|
||||
_ = x[MD_CLEAR-106]
|
||||
_ = x[MMX-107]
|
||||
_ = x[MMXEXT-108]
|
||||
_ = x[MOVBE-109]
|
||||
_ = x[MOVDIR64B-110]
|
||||
_ = x[MOVDIRI-111]
|
||||
_ = x[MOVSB_ZL-112]
|
||||
_ = x[MOVU-113]
|
||||
_ = x[MPX-114]
|
||||
_ = x[MSRIRC-115]
|
||||
_ = x[MSRLIST-116]
|
||||
_ = x[MSR_PAGEFLUSH-117]
|
||||
_ = x[NRIPS-118]
|
||||
_ = x[NX-119]
|
||||
_ = x[OSXSAVE-120]
|
||||
_ = x[PCONFIG-121]
|
||||
_ = x[POPCNT-122]
|
||||
_ = x[PPIN-123]
|
||||
_ = x[PREFETCHI-124]
|
||||
_ = x[PSFD-125]
|
||||
_ = x[RDPRU-126]
|
||||
_ = x[RDRAND-127]
|
||||
_ = x[RDSEED-128]
|
||||
_ = x[RDTSCP-129]
|
||||
_ = x[RRSBA_CTRL-130]
|
||||
_ = x[RTM-131]
|
||||
_ = x[RTM_ALWAYS_ABORT-132]
|
||||
_ = x[SBPB-133]
|
||||
_ = x[SERIALIZE-134]
|
||||
_ = x[SEV-135]
|
||||
_ = x[SEV_64BIT-136]
|
||||
_ = x[SEV_ALTERNATIVE-137]
|
||||
_ = x[SEV_DEBUGSWAP-138]
|
||||
_ = x[SEV_ES-139]
|
||||
_ = x[SEV_RESTRICTED-140]
|
||||
_ = x[SEV_SNP-141]
|
||||
_ = x[SGX-142]
|
||||
_ = x[SGXLC-143]
|
||||
_ = x[SHA-144]
|
||||
_ = x[SME-145]
|
||||
_ = x[SME_COHERENT-146]
|
||||
_ = x[SPEC_CTRL_SSBD-147]
|
||||
_ = x[SRBDS_CTRL-148]
|
||||
_ = x[SRSO_MSR_FIX-149]
|
||||
_ = x[SRSO_NO-150]
|
||||
_ = x[SRSO_USER_KERNEL_NO-151]
|
||||
_ = x[SSE-152]
|
||||
_ = x[SSE2-153]
|
||||
_ = x[SSE3-154]
|
||||
_ = x[SSE4-155]
|
||||
_ = x[SSE42-156]
|
||||
_ = x[SSE4A-157]
|
||||
_ = x[SSSE3-158]
|
||||
_ = x[STIBP-159]
|
||||
_ = x[STIBP_ALWAYSON-160]
|
||||
_ = x[STOSB_SHORT-161]
|
||||
_ = x[SUCCOR-162]
|
||||
_ = x[SVM-163]
|
||||
_ = x[SVMDA-164]
|
||||
_ = x[SVMFBASID-165]
|
||||
_ = x[SVML-166]
|
||||
_ = x[SVMNP-167]
|
||||
_ = x[SVMPF-168]
|
||||
_ = x[SVMPFT-169]
|
||||
_ = x[SYSCALL-170]
|
||||
_ = x[SYSEE-171]
|
||||
_ = x[TBM-172]
|
||||
_ = x[TDX_GUEST-173]
|
||||
_ = x[TLB_FLUSH_NESTED-174]
|
||||
_ = x[TME-175]
|
||||
_ = x[TOPEXT-176]
|
||||
_ = x[TSCRATEMSR-177]
|
||||
_ = x[TSXLDTRK-178]
|
||||
_ = x[VAES-179]
|
||||
_ = x[VMCBCLEAN-180]
|
||||
_ = x[VMPL-181]
|
||||
_ = x[VMSA_REGPROT-182]
|
||||
_ = x[VMX-183]
|
||||
_ = x[VPCLMULQDQ-184]
|
||||
_ = x[VTE-185]
|
||||
_ = x[WAITPKG-186]
|
||||
_ = x[WBNOINVD-187]
|
||||
_ = x[WRMSRNS-188]
|
||||
_ = x[X87-189]
|
||||
_ = x[XGETBV1-190]
|
||||
_ = x[XOP-191]
|
||||
_ = x[XSAVE-192]
|
||||
_ = x[XSAVEC-193]
|
||||
_ = x[XSAVEOPT-194]
|
||||
_ = x[XSAVES-195]
|
||||
_ = x[AESARM-196]
|
||||
_ = x[ARMCPUID-197]
|
||||
_ = x[ASIMD-198]
|
||||
_ = x[ASIMDDP-199]
|
||||
_ = x[ASIMDHP-200]
|
||||
_ = x[ASIMDRDM-201]
|
||||
_ = x[ATOMICS-202]
|
||||
_ = x[CRC32-203]
|
||||
_ = x[DCPOP-204]
|
||||
_ = x[EVTSTRM-205]
|
||||
_ = x[FCMA-206]
|
||||
_ = x[FP-207]
|
||||
_ = x[FPHP-208]
|
||||
_ = x[GPA-209]
|
||||
_ = x[JSCVT-210]
|
||||
_ = x[LRCPC-211]
|
||||
_ = x[PMULL-212]
|
||||
_ = x[SHA1-213]
|
||||
_ = x[SHA2-214]
|
||||
_ = x[SHA3-215]
|
||||
_ = x[SHA512-216]
|
||||
_ = x[SM3-217]
|
||||
_ = x[SM4-218]
|
||||
_ = x[SVE-219]
|
||||
_ = x[lastID-220]
|
||||
_ = x[AMXTF32-10]
|
||||
_ = x[AMXCOMPLEX-11]
|
||||
_ = x[APX_F-12]
|
||||
_ = x[AVX-13]
|
||||
_ = x[AVX10-14]
|
||||
_ = x[AVX10_128-15]
|
||||
_ = x[AVX10_256-16]
|
||||
_ = x[AVX10_512-17]
|
||||
_ = x[AVX2-18]
|
||||
_ = x[AVX512BF16-19]
|
||||
_ = x[AVX512BITALG-20]
|
||||
_ = x[AVX512BW-21]
|
||||
_ = x[AVX512CD-22]
|
||||
_ = x[AVX512DQ-23]
|
||||
_ = x[AVX512ER-24]
|
||||
_ = x[AVX512F-25]
|
||||
_ = x[AVX512FP16-26]
|
||||
_ = x[AVX512IFMA-27]
|
||||
_ = x[AVX512PF-28]
|
||||
_ = x[AVX512VBMI-29]
|
||||
_ = x[AVX512VBMI2-30]
|
||||
_ = x[AVX512VL-31]
|
||||
_ = x[AVX512VNNI-32]
|
||||
_ = x[AVX512VP2INTERSECT-33]
|
||||
_ = x[AVX512VPOPCNTDQ-34]
|
||||
_ = x[AVXIFMA-35]
|
||||
_ = x[AVXNECONVERT-36]
|
||||
_ = x[AVXSLOW-37]
|
||||
_ = x[AVXVNNI-38]
|
||||
_ = x[AVXVNNIINT8-39]
|
||||
_ = x[AVXVNNIINT16-40]
|
||||
_ = x[BHI_CTRL-41]
|
||||
_ = x[BMI1-42]
|
||||
_ = x[BMI2-43]
|
||||
_ = x[CETIBT-44]
|
||||
_ = x[CETSS-45]
|
||||
_ = x[CLDEMOTE-46]
|
||||
_ = x[CLMUL-47]
|
||||
_ = x[CLZERO-48]
|
||||
_ = x[CMOV-49]
|
||||
_ = x[CMPCCXADD-50]
|
||||
_ = x[CMPSB_SCADBS_SHORT-51]
|
||||
_ = x[CMPXCHG8-52]
|
||||
_ = x[CPBOOST-53]
|
||||
_ = x[CPPC-54]
|
||||
_ = x[CX16-55]
|
||||
_ = x[EFER_LMSLE_UNS-56]
|
||||
_ = x[ENQCMD-57]
|
||||
_ = x[ERMS-58]
|
||||
_ = x[F16C-59]
|
||||
_ = x[FLUSH_L1D-60]
|
||||
_ = x[FMA3-61]
|
||||
_ = x[FMA4-62]
|
||||
_ = x[FP128-63]
|
||||
_ = x[FP256-64]
|
||||
_ = x[FSRM-65]
|
||||
_ = x[FXSR-66]
|
||||
_ = x[FXSROPT-67]
|
||||
_ = x[GFNI-68]
|
||||
_ = x[HLE-69]
|
||||
_ = x[HRESET-70]
|
||||
_ = x[HTT-71]
|
||||
_ = x[HWA-72]
|
||||
_ = x[HYBRID_CPU-73]
|
||||
_ = x[HYPERVISOR-74]
|
||||
_ = x[IA32_ARCH_CAP-75]
|
||||
_ = x[IA32_CORE_CAP-76]
|
||||
_ = x[IBPB-77]
|
||||
_ = x[IBPB_BRTYPE-78]
|
||||
_ = x[IBRS-79]
|
||||
_ = x[IBRS_PREFERRED-80]
|
||||
_ = x[IBRS_PROVIDES_SMP-81]
|
||||
_ = x[IBS-82]
|
||||
_ = x[IBSBRNTRGT-83]
|
||||
_ = x[IBSFETCHSAM-84]
|
||||
_ = x[IBSFFV-85]
|
||||
_ = x[IBSOPCNT-86]
|
||||
_ = x[IBSOPCNTEXT-87]
|
||||
_ = x[IBSOPSAM-88]
|
||||
_ = x[IBSRDWROPCNT-89]
|
||||
_ = x[IBSRIPINVALIDCHK-90]
|
||||
_ = x[IBS_FETCH_CTLX-91]
|
||||
_ = x[IBS_OPDATA4-92]
|
||||
_ = x[IBS_OPFUSE-93]
|
||||
_ = x[IBS_PREVENTHOST-94]
|
||||
_ = x[IBS_ZEN4-95]
|
||||
_ = x[IDPRED_CTRL-96]
|
||||
_ = x[INT_WBINVD-97]
|
||||
_ = x[INVLPGB-98]
|
||||
_ = x[KEYLOCKER-99]
|
||||
_ = x[KEYLOCKERW-100]
|
||||
_ = x[LAHF-101]
|
||||
_ = x[LAM-102]
|
||||
_ = x[LBRVIRT-103]
|
||||
_ = x[LZCNT-104]
|
||||
_ = x[MCAOVERFLOW-105]
|
||||
_ = x[MCDT_NO-106]
|
||||
_ = x[MCOMMIT-107]
|
||||
_ = x[MD_CLEAR-108]
|
||||
_ = x[MMX-109]
|
||||
_ = x[MMXEXT-110]
|
||||
_ = x[MOVBE-111]
|
||||
_ = x[MOVDIR64B-112]
|
||||
_ = x[MOVDIRI-113]
|
||||
_ = x[MOVSB_ZL-114]
|
||||
_ = x[MOVU-115]
|
||||
_ = x[MPX-116]
|
||||
_ = x[MSRIRC-117]
|
||||
_ = x[MSRLIST-118]
|
||||
_ = x[MSR_PAGEFLUSH-119]
|
||||
_ = x[NRIPS-120]
|
||||
_ = x[NX-121]
|
||||
_ = x[OSXSAVE-122]
|
||||
_ = x[PCONFIG-123]
|
||||
_ = x[POPCNT-124]
|
||||
_ = x[PPIN-125]
|
||||
_ = x[PREFETCHI-126]
|
||||
_ = x[PSFD-127]
|
||||
_ = x[RDPRU-128]
|
||||
_ = x[RDRAND-129]
|
||||
_ = x[RDSEED-130]
|
||||
_ = x[RDTSCP-131]
|
||||
_ = x[RRSBA_CTRL-132]
|
||||
_ = x[RTM-133]
|
||||
_ = x[RTM_ALWAYS_ABORT-134]
|
||||
_ = x[SBPB-135]
|
||||
_ = x[SERIALIZE-136]
|
||||
_ = x[SEV-137]
|
||||
_ = x[SEV_64BIT-138]
|
||||
_ = x[SEV_ALTERNATIVE-139]
|
||||
_ = x[SEV_DEBUGSWAP-140]
|
||||
_ = x[SEV_ES-141]
|
||||
_ = x[SEV_RESTRICTED-142]
|
||||
_ = x[SEV_SNP-143]
|
||||
_ = x[SGX-144]
|
||||
_ = x[SGXLC-145]
|
||||
_ = x[SHA-146]
|
||||
_ = x[SME-147]
|
||||
_ = x[SME_COHERENT-148]
|
||||
_ = x[SPEC_CTRL_SSBD-149]
|
||||
_ = x[SRBDS_CTRL-150]
|
||||
_ = x[SRSO_MSR_FIX-151]
|
||||
_ = x[SRSO_NO-152]
|
||||
_ = x[SRSO_USER_KERNEL_NO-153]
|
||||
_ = x[SSE-154]
|
||||
_ = x[SSE2-155]
|
||||
_ = x[SSE3-156]
|
||||
_ = x[SSE4-157]
|
||||
_ = x[SSE42-158]
|
||||
_ = x[SSE4A-159]
|
||||
_ = x[SSSE3-160]
|
||||
_ = x[STIBP-161]
|
||||
_ = x[STIBP_ALWAYSON-162]
|
||||
_ = x[STOSB_SHORT-163]
|
||||
_ = x[SUCCOR-164]
|
||||
_ = x[SVM-165]
|
||||
_ = x[SVMDA-166]
|
||||
_ = x[SVMFBASID-167]
|
||||
_ = x[SVML-168]
|
||||
_ = x[SVMNP-169]
|
||||
_ = x[SVMPF-170]
|
||||
_ = x[SVMPFT-171]
|
||||
_ = x[SYSCALL-172]
|
||||
_ = x[SYSEE-173]
|
||||
_ = x[TBM-174]
|
||||
_ = x[TDX_GUEST-175]
|
||||
_ = x[TLB_FLUSH_NESTED-176]
|
||||
_ = x[TME-177]
|
||||
_ = x[TOPEXT-178]
|
||||
_ = x[TSCRATEMSR-179]
|
||||
_ = x[TSXLDTRK-180]
|
||||
_ = x[VAES-181]
|
||||
_ = x[VMCBCLEAN-182]
|
||||
_ = x[VMPL-183]
|
||||
_ = x[VMSA_REGPROT-184]
|
||||
_ = x[VMX-185]
|
||||
_ = x[VPCLMULQDQ-186]
|
||||
_ = x[VTE-187]
|
||||
_ = x[WAITPKG-188]
|
||||
_ = x[WBNOINVD-189]
|
||||
_ = x[WRMSRNS-190]
|
||||
_ = x[X87-191]
|
||||
_ = x[XGETBV1-192]
|
||||
_ = x[XOP-193]
|
||||
_ = x[XSAVE-194]
|
||||
_ = x[XSAVEC-195]
|
||||
_ = x[XSAVEOPT-196]
|
||||
_ = x[XSAVES-197]
|
||||
_ = x[AESARM-198]
|
||||
_ = x[ARMCPUID-199]
|
||||
_ = x[ASIMD-200]
|
||||
_ = x[ASIMDDP-201]
|
||||
_ = x[ASIMDHP-202]
|
||||
_ = x[ASIMDRDM-203]
|
||||
_ = x[ATOMICS-204]
|
||||
_ = x[CRC32-205]
|
||||
_ = x[DCPOP-206]
|
||||
_ = x[EVTSTRM-207]
|
||||
_ = x[FCMA-208]
|
||||
_ = x[FHM-209]
|
||||
_ = x[FP-210]
|
||||
_ = x[FPHP-211]
|
||||
_ = x[GPA-212]
|
||||
_ = x[JSCVT-213]
|
||||
_ = x[LRCPC-214]
|
||||
_ = x[PMULL-215]
|
||||
_ = x[RNDR-216]
|
||||
_ = x[TLB-217]
|
||||
_ = x[TS-218]
|
||||
_ = x[SHA1-219]
|
||||
_ = x[SHA2-220]
|
||||
_ = x[SHA3-221]
|
||||
_ = x[SHA512-222]
|
||||
_ = x[SM3-223]
|
||||
_ = x[SM4-224]
|
||||
_ = x[SVE-225]
|
||||
_ = x[lastID-226]
|
||||
_ = x[firstID-0]
|
||||
}
|
||||
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 73, 76, 81, 90, 99, 108, 112, 122, 134, 142, 150, 158, 166, 173, 183, 193, 201, 211, 222, 230, 240, 258, 273, 280, 292, 299, 306, 317, 329, 337, 341, 345, 351, 356, 364, 369, 375, 379, 388, 406, 414, 421, 425, 429, 443, 449, 453, 457, 466, 470, 474, 479, 484, 488, 492, 499, 503, 506, 512, 515, 518, 528, 538, 551, 564, 568, 579, 583, 597, 614, 617, 627, 638, 644, 652, 663, 671, 683, 699, 713, 724, 734, 749, 757, 768, 778, 785, 794, 804, 808, 811, 818, 823, 834, 841, 848, 856, 859, 865, 870, 879, 886, 894, 898, 901, 907, 914, 927, 932, 934, 941, 948, 954, 958, 967, 971, 976, 982, 988, 994, 1004, 1007, 1023, 1027, 1036, 1039, 1048, 1063, 1076, 1082, 1096, 1103, 1106, 1111, 1114, 1117, 1129, 1143, 1153, 1165, 1172, 1191, 1194, 1198, 1202, 1206, 1211, 1216, 1221, 1226, 1240, 1251, 1257, 1260, 1265, 1274, 1278, 1283, 1288, 1294, 1301, 1306, 1309, 1318, 1334, 1337, 1343, 1353, 1361, 1365, 1374, 1378, 1390, 1393, 1403, 1406, 1413, 1421, 1428, 1431, 1438, 1441, 1446, 1452, 1460, 1466, 1472, 1480, 1485, 1492, 1499, 1507, 1514, 1519, 1524, 1531, 1535, 1537, 1541, 1544, 1549, 1554, 1559, 1563, 1567, 1571, 1577, 1580, 1583, 1586, 1592}
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 90, 93, 98, 107, 116, 125, 129, 139, 151, 159, 167, 175, 183, 190, 200, 210, 218, 228, 239, 247, 257, 275, 290, 297, 309, 316, 323, 334, 346, 354, 358, 362, 368, 373, 381, 386, 392, 396, 405, 423, 431, 438, 442, 446, 460, 466, 470, 474, 483, 487, 491, 496, 501, 505, 509, 516, 520, 523, 529, 532, 535, 545, 555, 568, 581, 585, 596, 600, 614, 631, 634, 644, 655, 661, 669, 680, 688, 700, 716, 730, 741, 751, 766, 774, 785, 795, 802, 811, 821, 825, 828, 835, 840, 851, 858, 865, 873, 876, 882, 887, 896, 903, 911, 915, 918, 924, 931, 944, 949, 951, 958, 965, 971, 975, 984, 988, 993, 999, 1005, 1011, 1021, 1024, 1040, 1044, 1053, 1056, 1065, 1080, 1093, 1099, 1113, 1120, 1123, 1128, 1131, 1134, 1146, 1160, 1170, 1182, 1189, 1208, 1211, 1215, 1219, 1223, 1228, 1233, 1238, 1243, 1257, 1268, 1274, 1277, 1282, 1291, 1295, 1300, 1305, 1311, 1318, 1323, 1326, 1335, 1351, 1354, 1360, 1370, 1378, 1382, 1391, 1395, 1407, 1410, 1420, 1423, 1430, 1438, 1445, 1448, 1455, 1458, 1463, 1469, 1477, 1483, 1489, 1497, 1502, 1509, 1516, 1524, 1531, 1536, 1541, 1548, 1552, 1555, 1557, 1561, 1564, 1569, 1574, 1579, 1583, 1586, 1588, 1592, 1596, 1600, 1606, 1609, 1612, 1615, 1621}
|
||||
|
||||
func (i FeatureID) String() string {
|
||||
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
|
||||
|
||||
Loaded 100 of 273 files, more files were not shown because too many files have changed in this diff.
Show more
Reference in new issue
Block a user