mirror of
https://github.com/opencloud-eu/opencloud.git
synced 2026-02-14 08:11:21 -05:00
Compare commits
4 Commits
v2.1.0
...
debug-ci-f
| Author | SHA1 | Date | |
|---|---|---|---|
|
|
9d330ab009 | ||
|
|
b4fae4681e | ||
|
|
2eff6b7736 | ||
|
|
1e167e0236 |
1
.github/settings.yml
vendored
1
.github/settings.yml
vendored
@@ -1 +1,2 @@
|
||||
_extends: gh-labels
|
||||
|
||||
|
||||
28
.github/workflows/labels.yml
vendored
28
.github/workflows/labels.yml
vendored
@@ -1,28 +0,0 @@
|
||||
name: Require Pull Request Labels
|
||||
on:
|
||||
pull_request:
|
||||
types: [opened, labeled, unlabeled, synchronize]
|
||||
jobs:
|
||||
label:
|
||||
runs-on: ubuntu-latest
|
||||
permissions:
|
||||
issues: write
|
||||
pull-requests: write
|
||||
steps:
|
||||
- uses: mheap/github-action-required-labels@v5
|
||||
with:
|
||||
mode: minimum
|
||||
count: 1
|
||||
labels: |
|
||||
Type:Bug
|
||||
Type:Enhancement
|
||||
Type:Feature
|
||||
Type:Breaking-Change
|
||||
Type:Test
|
||||
Type:Documentation
|
||||
Type:Maintenance
|
||||
Type:Security
|
||||
Type:Dependencies
|
||||
Type:DevOps
|
||||
dependencies
|
||||
add_comment: true
|
||||
15
.make/go.mk
15
.make/go.mk
@@ -18,20 +18,21 @@ SOURCES ?= $(shell find . -name "*.go" -type f -not -path "./node_modules/*")
|
||||
TAGS ?=
|
||||
|
||||
ifndef OUTPUT
|
||||
ifneq ($(CI_COMMIT_TAG),)
|
||||
OUTPUT ?= $(subst v,,$(CI_COMMIT_TAG))
|
||||
ifneq ($(DRONE_TAG),)
|
||||
OUTPUT ?= $(subst v,,$(DRONE_TAG))
|
||||
else
|
||||
OUTPUT ?= testing
|
||||
endif
|
||||
endif
|
||||
|
||||
ifeq ($(VERSION), daily)
|
||||
STRING ?= $(shell git rev-parse --short HEAD)
|
||||
else ifeq ($(VERSION),)
|
||||
STRING ?= $(shell git rev-parse --short HEAD)
|
||||
ifndef VERSION
|
||||
ifneq ($(DRONE_TAG),)
|
||||
VERSION ?= $(subst v,,$(DRONE_TAG))
|
||||
else
|
||||
STRING ?= $(shell git rev-parse --short HEAD)
|
||||
endif
|
||||
endif
|
||||
|
||||
|
||||
ifndef DATE
|
||||
DATE := $(shell date -u '+%Y%m%d')
|
||||
endif
|
||||
|
||||
@@ -1,3 +1,3 @@
|
||||
# The test runner source for UI tests
|
||||
WEB_COMMITID=25629bf0d846051ec0ed6f56ddbeb1a4de6f9ba0
|
||||
WEB_COMMITID=a85b8b2f0b22d2e8fa133fee2dae8cc866c0c8c2
|
||||
WEB_BRANCH=main
|
||||
|
||||
212
.woodpecker.star
212
.woodpecker.star
@@ -44,7 +44,6 @@ PLUGINS_S3_CACHE = "plugins/s3-cache:1"
|
||||
PLUGINS_SLACK = "plugins/slack:1"
|
||||
REDIS = "redis:6-alpine"
|
||||
SONARSOURCE_SONAR_SCANNER_CLI = "sonarsource/sonar-scanner-cli:11.0"
|
||||
READY_RELEASE_GO = "woodpeckerci/plugin-ready-release-go:latest"
|
||||
|
||||
DEFAULT_PHP_VERSION = "8.2"
|
||||
DEFAULT_NODEJS_VERSION = "20"
|
||||
@@ -81,10 +80,10 @@ OC_FED_DOMAIN = "%s:10200" % FED_OC_SERVER_NAME
|
||||
# configuration
|
||||
config = {
|
||||
"cs3ApiTests": {
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
},
|
||||
"wopiValidatorTests": {
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
},
|
||||
"k6LoadTests": {
|
||||
"skip": True,
|
||||
@@ -101,13 +100,13 @@ config = {
|
||||
"apiLocks",
|
||||
"apiActivities",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
},
|
||||
"settings": {
|
||||
"suites": [
|
||||
"apiSettings",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
"withRemotePhp": [True],
|
||||
"emailNeeded": True,
|
||||
"extraEnvironment": {
|
||||
@@ -128,45 +127,45 @@ config = {
|
||||
"apiGraph",
|
||||
"apiServiceAvailability",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
"withRemotePhp": [True],
|
||||
},
|
||||
"graphUserGroup": {
|
||||
"suites": [
|
||||
"apiGraphUserGroup",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
"withRemotePhp": [True],
|
||||
},
|
||||
"spaces": {
|
||||
"suites": [
|
||||
"apiSpaces",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
},
|
||||
"spacesShares": {
|
||||
"suites": [
|
||||
"apiSpacesShares",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
},
|
||||
"spacesDavOperation": {
|
||||
"suites": [
|
||||
"apiSpacesDavOperation",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
},
|
||||
"search1": {
|
||||
"suites": [
|
||||
"apiSearch1",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
},
|
||||
"search2": {
|
||||
"suites": [
|
||||
"apiSearch2",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
},
|
||||
"sharingNg": {
|
||||
"suites": [
|
||||
@@ -174,23 +173,23 @@ config = {
|
||||
"apiSharingNg1",
|
||||
"apiSharingNg2",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
},
|
||||
"sharingNgShareInvitation": {
|
||||
"suites": [
|
||||
"apiSharingNgShareInvitation",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
},
|
||||
"sharingNgLinkShare": {
|
||||
"suites": [
|
||||
"apiSharingNgLinkSharePermission",
|
||||
"apiSharingNgLinkShareRoot",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
},
|
||||
"accountsHashDifficulty": {
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
"suites": [
|
||||
"apiAccountsHashDifficulty",
|
||||
],
|
||||
@@ -200,7 +199,7 @@ config = {
|
||||
"suites": [
|
||||
"apiNotification",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
"withRemotePhp": [True],
|
||||
"emailNeeded": True,
|
||||
"extraEnvironment": {
|
||||
@@ -220,7 +219,7 @@ config = {
|
||||
"suites": [
|
||||
"apiAntivirus",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
"antivirusNeeded": True,
|
||||
"extraServerEnvironment": {
|
||||
"ANTIVIRUS_SCANNER_TYPE": "clamav",
|
||||
@@ -235,14 +234,14 @@ config = {
|
||||
"suites": [
|
||||
"apiSearchContent",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
"tikaNeeded": True,
|
||||
},
|
||||
"ocm": {
|
||||
"suites": [
|
||||
"apiOcm",
|
||||
],
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
"withRemotePhp": [True],
|
||||
"federationServer": True,
|
||||
"emailNeeded": True,
|
||||
@@ -304,19 +303,19 @@ config = {
|
||||
},
|
||||
"e2eTests": {
|
||||
"part": {
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
"totalParts": 4, # divide and run all suites in parts (divide pipelines)
|
||||
"xsuites": ["search", "app-provider", "app-provider-onlyOffice", "app-store", "keycloak", "oidc", "ocm"], # suites to skip
|
||||
},
|
||||
"search": {
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
"suites": ["search"], # suites to run
|
||||
"tikaNeeded": True,
|
||||
},
|
||||
},
|
||||
"e2eMultiService": {
|
||||
"testSuites": {
|
||||
"skip": False,
|
||||
"skip": True,
|
||||
"suites": [
|
||||
"smoke",
|
||||
"shares",
|
||||
@@ -416,8 +415,10 @@ def main(ctx):
|
||||
none
|
||||
"""
|
||||
|
||||
pipelines = []
|
||||
|
||||
build_release_helpers = \
|
||||
readyReleaseGo() + \
|
||||
changelog() + \
|
||||
docs()
|
||||
|
||||
build_release_helpers.append(
|
||||
@@ -429,8 +430,8 @@ def main(ctx):
|
||||
|
||||
test_pipelines = \
|
||||
codestyle(ctx) + \
|
||||
checkGherkinLint() + \
|
||||
checkTestSuitesInExpectedFailures() + \
|
||||
checkGherkinLint(ctx) + \
|
||||
checkTestSuitesInExpectedFailures(ctx) + \
|
||||
buildWebCache(ctx) + \
|
||||
getGoBinForTesting(ctx) + \
|
||||
buildOpencloudBinaryForTesting(ctx) + \
|
||||
@@ -472,7 +473,7 @@ def main(ctx):
|
||||
),
|
||||
)
|
||||
|
||||
pipelineSanityChecks(pipelines)
|
||||
pipelineSanityChecks(ctx, pipelines)
|
||||
return pipelines
|
||||
|
||||
def cachePipeline(name, steps):
|
||||
@@ -770,7 +771,7 @@ def vendorbinCodesniffer(phpVersion):
|
||||
],
|
||||
}]
|
||||
|
||||
def checkTestSuitesInExpectedFailures():
|
||||
def checkTestSuitesInExpectedFailures(ctx):
|
||||
return [{
|
||||
"name": "check-suites-in-expected-failures",
|
||||
"steps": [
|
||||
@@ -789,7 +790,7 @@ def checkTestSuitesInExpectedFailures():
|
||||
],
|
||||
}]
|
||||
|
||||
def checkGherkinLint():
|
||||
def checkGherkinLint(ctx):
|
||||
return [{
|
||||
"name": "check-gherkin-standard",
|
||||
"steps": [
|
||||
@@ -930,7 +931,7 @@ def localApiTestPipeline(ctx):
|
||||
(opencloudServer(storage, params["accounts_hash_difficulty"], deploy_type = "federation", extra_server_environment = params["extraServerEnvironment"]) if params["federationServer"] else []) +
|
||||
((wopiCollaborationService("fakeoffice") + wopiCollaborationService("collabora") + wopiCollaborationService("onlyoffice")) if params["collaborationServiceNeeded"] else []) +
|
||||
(openCloudHealthCheck("wopi", ["wopi-collabora:9304", "wopi-onlyoffice:9304", "wopi-fakeoffice:9304"]) if params["collaborationServiceNeeded"] else []) +
|
||||
localApiTests(name, params["suites"], storage, params["extraEnvironment"], run_with_remote_php) +
|
||||
localApiTests(ctx, name, params["suites"], storage, params["extraEnvironment"], run_with_remote_php) +
|
||||
logRequests(),
|
||||
"services": (emailService() if params["emailNeeded"] else []) +
|
||||
(clamavService() if params["antivirusNeeded"] else []) +
|
||||
@@ -952,9 +953,9 @@ def localApiTestPipeline(ctx):
|
||||
pipelines.append(pipeline)
|
||||
return pipelines
|
||||
|
||||
def localApiTests(name, suites, storage = "decomposed", extra_environment = {}, with_remote_php = False):
|
||||
def localApiTests(ctx, name, suites, storage = "decomposed", extra_environment = {}, with_remote_php = False):
|
||||
test_dir = "%s/tests/acceptance" % dirs["base"]
|
||||
expected_failures_file = "%s/expected-failures-localAPI-on-decomposed-storage.md" % test_dir
|
||||
expected_failures_file = "%s/expected-failures-localAPI-on-decomposed-storage.md" % (test_dir)
|
||||
|
||||
environment = {
|
||||
"TEST_SERVER_URL": OC_URL,
|
||||
@@ -988,7 +989,7 @@ def cs3ApiTests(ctx, storage, accounts_hash_difficulty = 4):
|
||||
return {
|
||||
"name": "cs3ApiTests-%s" % storage,
|
||||
"steps": restoreBuildArtifactCache(ctx, dirs["opencloudBinArtifact"], dirs["opencloudBinPath"]) +
|
||||
opencloudServer(storage, accounts_hash_difficulty, deploy_type = "cs3api_validator") +
|
||||
opencloudServer(storage, accounts_hash_difficulty, [], [], "cs3api_validator") +
|
||||
[
|
||||
{
|
||||
"name": "cs3ApiTests",
|
||||
@@ -1034,6 +1035,7 @@ def wopiValidatorTests(ctx, storage, wopiServerType, accounts_hash_difficulty =
|
||||
]
|
||||
|
||||
validatorTests = []
|
||||
wopiServer = []
|
||||
extra_server_environment = {}
|
||||
|
||||
if wopiServerType == "cs3":
|
||||
@@ -1201,7 +1203,7 @@ def apiTests(ctx):
|
||||
|
||||
for runPart in range(1, config["apiTests"]["numberOfParts"] + 1):
|
||||
for run_with_remote_php in defaults["withRemotePhp"]:
|
||||
if not debugPartsEnabled or (debugPartsEnabled and runPart in debugParts):
|
||||
if (not debugPartsEnabled or (debugPartsEnabled and runPart in debugParts)):
|
||||
pipelines.append(coreApiTests(ctx, runPart, config["apiTests"]["numberOfParts"], run_with_remote_php))
|
||||
|
||||
return pipelines
|
||||
@@ -1241,10 +1243,10 @@ def e2eTestPipeline(ctx):
|
||||
|
||||
pipelines = []
|
||||
|
||||
if "skip-e2e" in ctx.build.title.lower():
|
||||
if ("skip-e2e" in ctx.build.title.lower()):
|
||||
return pipelines
|
||||
|
||||
if ctx.build.event == "tag":
|
||||
if (ctx.build.event == "tag"):
|
||||
return pipelines
|
||||
|
||||
storage = "posix"
|
||||
@@ -1344,11 +1346,11 @@ def multiServiceE2ePipeline(ctx):
|
||||
},
|
||||
]
|
||||
|
||||
if "skip-e2e" in ctx.build.title.lower():
|
||||
if ("skip-e2e" in ctx.build.title.lower()):
|
||||
return pipelines
|
||||
|
||||
# run this pipeline only for cron jobs and full-ci PRs
|
||||
if not "full-ci" in ctx.build.title.lower() and ctx.build.event != "cron":
|
||||
if (not "full-ci" in ctx.build.title.lower() and ctx.build.event != "cron"):
|
||||
return pipelines
|
||||
|
||||
storage = "posix"
|
||||
@@ -1452,7 +1454,7 @@ def multiServiceE2ePipeline(ctx):
|
||||
})
|
||||
return pipelines
|
||||
|
||||
def uploadTracingResult():
|
||||
def uploadTracingResult(ctx):
|
||||
return [{
|
||||
"name": "upload-tracing-result",
|
||||
"image": PLUGINS_S3,
|
||||
@@ -1546,7 +1548,7 @@ def dockerReleases(ctx):
|
||||
|
||||
def dockerRelease(ctx, repo, build_type):
|
||||
build_args = [
|
||||
"REVISION=%s" % ctx.build.commit,
|
||||
"REVISION=%s" % (ctx.build.commit),
|
||||
"VERSION=%s" % (ctx.build.ref.replace("refs/tags/", "") if ctx.build.event == "tag" else "daily"),
|
||||
]
|
||||
|
||||
@@ -1692,6 +1694,19 @@ def binaryRelease(ctx, arch, depends_on = []):
|
||||
},
|
||||
],
|
||||
},
|
||||
{
|
||||
"name": "changelog",
|
||||
"image": OC_CI_GOLANG,
|
||||
"environment": CI_HTTP_PROXY_ENV,
|
||||
"commands": [
|
||||
"make changelog CHANGELOG_VERSION=%s" % ctx.build.ref.replace("refs/tags/v", ""),
|
||||
],
|
||||
"when": [
|
||||
{
|
||||
"event": "tag",
|
||||
},
|
||||
],
|
||||
},
|
||||
{
|
||||
"name": "release",
|
||||
"image": PLUGINS_GITHUB_RELEASE,
|
||||
@@ -1703,6 +1718,8 @@ def binaryRelease(ctx, arch, depends_on = []):
|
||||
"opencloud/dist/release/*",
|
||||
],
|
||||
"title": ctx.build.ref.replace("refs/tags/v", ""),
|
||||
"note": "opencloud/dist/CHANGELOG.md",
|
||||
"overwrite": True,
|
||||
"prerelease": len(ctx.build.ref.split("-")) > 1,
|
||||
},
|
||||
"when": [
|
||||
@@ -1771,6 +1788,19 @@ def licenseCheck(ctx):
|
||||
"cd third-party-licenses && tar -czf ../third-party-licenses.tar.gz *",
|
||||
],
|
||||
},
|
||||
{
|
||||
"name": "changelog",
|
||||
"image": OC_CI_GOLANG,
|
||||
"environment": CI_HTTP_PROXY_ENV,
|
||||
"commands": [
|
||||
"make changelog CHANGELOG_VERSION=%s" % ctx.build.ref.replace("refs/tags/v", "").split("-")[0],
|
||||
],
|
||||
"when": [
|
||||
{
|
||||
"event": "tag",
|
||||
},
|
||||
],
|
||||
},
|
||||
{
|
||||
"name": "release",
|
||||
"image": PLUGINS_GITHUB_RELEASE,
|
||||
@@ -1782,6 +1812,8 @@ def licenseCheck(ctx):
|
||||
"third-party-licenses.tar.gz",
|
||||
],
|
||||
"title": ctx.build.ref.replace("refs/tags/v", ""),
|
||||
"note": "opencloud/dist/CHANGELOG.md",
|
||||
"overwrite": True,
|
||||
"prerelease": len(ctx.build.ref.split("-")) > 1,
|
||||
},
|
||||
"when": [
|
||||
@@ -1806,20 +1838,53 @@ def licenseCheck(ctx):
|
||||
"workspace": workspace,
|
||||
}
|
||||
|
||||
def readyReleaseGo():
|
||||
def changelog():
|
||||
return [{
|
||||
"name": "ready-release-go",
|
||||
"name": "changelog",
|
||||
"steps": [
|
||||
{
|
||||
"name": "release-helper",
|
||||
"image": READY_RELEASE_GO,
|
||||
"name": "generate",
|
||||
"image": OC_CI_GOLANG,
|
||||
"environment": CI_HTTP_PROXY_ENV,
|
||||
"commands": [
|
||||
"make -C opencloud changelog",
|
||||
],
|
||||
},
|
||||
{
|
||||
"name": "diff",
|
||||
"image": OC_CI_ALPINE,
|
||||
"commands": [
|
||||
"git diff",
|
||||
],
|
||||
},
|
||||
{
|
||||
"name": "output",
|
||||
"image": OC_CI_ALPINE,
|
||||
"commands": [
|
||||
"cat CHANGELOG.md",
|
||||
],
|
||||
},
|
||||
{
|
||||
"name": "publish",
|
||||
"image": PLUGINS_GIT_PUSH,
|
||||
"settings": {
|
||||
"git_email": "devops@opencloud.eu",
|
||||
"forge_type": "github",
|
||||
"forge_token": {
|
||||
"from_secret": "github_token",
|
||||
"branch": "main",
|
||||
"remote": "ssh://git@github.com/%s.git" % repo_slug,
|
||||
"commit": True,
|
||||
"ssh_key": {
|
||||
"from_secret": "ssh_key",
|
||||
},
|
||||
"commit_message": "Automated changelog update [skip ci]",
|
||||
"author_email": "devops@opencloud.eu",
|
||||
"author_name": "openclouders",
|
||||
"rebase": True,
|
||||
},
|
||||
"when": [
|
||||
{
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
],
|
||||
},
|
||||
],
|
||||
"when": [
|
||||
@@ -1827,6 +1892,9 @@ def readyReleaseGo():
|
||||
"event": ["push", "manual"],
|
||||
"branch": "main",
|
||||
},
|
||||
{
|
||||
"event": "pull_request",
|
||||
},
|
||||
],
|
||||
}]
|
||||
|
||||
@@ -1845,7 +1913,7 @@ def releaseDockerReadme(repo, build_type):
|
||||
"from_secret": "docker_password",
|
||||
},
|
||||
"PUSHRM_TARGET": repo,
|
||||
"PUSHRM_SHORT": "Docker images for %s" % repo,
|
||||
"PUSHRM_SHORT": "Docker images for %s" % (repo),
|
||||
"PUSHRM_FILE": "README.md",
|
||||
},
|
||||
},
|
||||
@@ -1905,7 +1973,7 @@ def makeNodeGenerate(module):
|
||||
if module == "":
|
||||
make = "make"
|
||||
else:
|
||||
make = "make -C %s" % module
|
||||
make = "make -C %s" % (module)
|
||||
return [
|
||||
{
|
||||
"name": "generate nodejs",
|
||||
@@ -1915,7 +1983,7 @@ def makeNodeGenerate(module):
|
||||
},
|
||||
"commands": [
|
||||
"pnpm config set store-dir ./.pnpm-store",
|
||||
"for i in $(seq 3); do %s node-generate-prod && break || sleep 1; done" % make,
|
||||
"for i in $(seq 3); do %s node-generate-prod && break || sleep 1; done" % (make),
|
||||
],
|
||||
},
|
||||
]
|
||||
@@ -1924,13 +1992,13 @@ def makeGoGenerate(module):
|
||||
if module == "":
|
||||
make = "make"
|
||||
else:
|
||||
make = "make -C %s" % module
|
||||
make = "make -C %s" % (module)
|
||||
return [
|
||||
{
|
||||
"name": "generate go",
|
||||
"image": OC_CI_GOLANG,
|
||||
"commands": [
|
||||
"for i in $(seq 3); do %s go-generate && break || sleep 1; done" % make,
|
||||
"for i in $(seq 3); do %s go-generate && break || sleep 1; done" % (make),
|
||||
],
|
||||
"environment": CI_HTTP_PROXY_ENV,
|
||||
},
|
||||
@@ -1969,13 +2037,13 @@ def notify(ctx):
|
||||
"runs_on": status,
|
||||
}
|
||||
|
||||
def opencloudServer(storage = "decomposed", accounts_hash_difficulty = 4, depends_on = [], deploy_type = "", extra_server_environment = {}, with_wrapper = False, tika_enabled = False):
|
||||
def opencloudServer(storage = "decomposed", accounts_hash_difficulty = 4, volumes = [], depends_on = [], deploy_type = "", extra_server_environment = {}, with_wrapper = False, tika_enabled = False):
|
||||
user = "0:0"
|
||||
container_name = OC_SERVER_NAME
|
||||
environment = {
|
||||
"OC_URL": OC_URL,
|
||||
"OC_CONFIG_DIR": "/root/.opencloud/config", # needed for checking config later
|
||||
"STORAGE_USERS_DRIVER": "%s" % storage,
|
||||
"STORAGE_USERS_DRIVER": "%s" % (storage),
|
||||
"PROXY_ENABLE_BASIC_AUTH": True,
|
||||
"WEB_UI_CONFIG_FILE": "%s/%s" % (dirs["base"], dirs["opencloudConfig"]),
|
||||
"OC_LOG_LEVEL": "error",
|
||||
@@ -2065,7 +2133,7 @@ def opencloudServer(storage = "decomposed", accounts_hash_difficulty = 4, depend
|
||||
# That will allow OpenCloud to use whatever its built-in default is.
|
||||
# Otherwise pass in a value from 4 to about 11 or 12 (default 4, for making regular tests fast)
|
||||
# The high values cause lots of CPU to be used when hashing passwords, and really slow down the tests.
|
||||
if accounts_hash_difficulty != "default":
|
||||
if (accounts_hash_difficulty != "default"):
|
||||
environment["ACCOUNTS_HASH_DIFFICULTY"] = accounts_hash_difficulty
|
||||
|
||||
for item in extra_server_environment:
|
||||
@@ -2078,7 +2146,7 @@ def opencloudServer(storage = "decomposed", accounts_hash_difficulty = 4, depend
|
||||
]
|
||||
|
||||
wait_for_opencloud = {
|
||||
"name": "wait-for-%s" % container_name,
|
||||
"name": "wait-for-%s" % (container_name),
|
||||
"image": OC_CI_ALPINE,
|
||||
"commands": [
|
||||
# wait for opencloud-server to be ready (5 minutes)
|
||||
@@ -2102,7 +2170,7 @@ def opencloudServer(storage = "decomposed", accounts_hash_difficulty = 4, depend
|
||||
"%s init --insecure true" % dirs["opencloudBin"],
|
||||
"cat $OC_CONFIG_DIR/opencloud.yaml",
|
||||
"cp tests/config/woodpecker/app-registry.yaml $OC_CONFIG_DIR/app-registry.yaml",
|
||||
] + wrapper_commands,
|
||||
] + (wrapper_commands),
|
||||
}
|
||||
|
||||
steps = [
|
||||
@@ -2174,12 +2242,18 @@ def build():
|
||||
]
|
||||
|
||||
def skipIfUnchanged(ctx, type):
|
||||
## FIXME: the 'exclude' feature (https://woodpecker-ci.org/docs/usage/workflow-syntax#path) does not seem to provide
|
||||
# what we need. It seems to skip the build as soon as one of the changed files matches an exclude pattern, we only
|
||||
# want to skip of ALL changed files match. So skip this condition for now:
|
||||
return []
|
||||
|
||||
if "full-ci" in ctx.build.title.lower() or ctx.build.event == "tag" or ctx.build.event == "cron":
|
||||
return []
|
||||
|
||||
base = [
|
||||
".github/**",
|
||||
".vscode/**",
|
||||
"changelog/**",
|
||||
"docs/**",
|
||||
"deployments/**",
|
||||
"CHANGELOG.md",
|
||||
@@ -2203,6 +2277,8 @@ def skipIfUnchanged(ctx, type):
|
||||
skip = base + unit + acceptance
|
||||
elif type == "cache":
|
||||
skip = base
|
||||
else:
|
||||
return []
|
||||
|
||||
return skip
|
||||
|
||||
@@ -2234,13 +2310,13 @@ def example_deploys(ctx):
|
||||
|
||||
deploys = []
|
||||
for config in configs:
|
||||
deploys.append(deploy(config, rebuild))
|
||||
deploys.append(deploy(ctx, config, rebuild))
|
||||
|
||||
return deploys
|
||||
|
||||
def deploy(config, rebuild):
|
||||
def deploy(ctx, config, rebuild):
|
||||
return {
|
||||
"name": "deploy_%s" % config,
|
||||
"name": "deploy_%s" % (config),
|
||||
"steps": [
|
||||
{
|
||||
"name": "clone continuous deployment playbook",
|
||||
@@ -2255,7 +2331,7 @@ def deploy(config, rebuild):
|
||||
"image": OC_CI_DRONE_ANSIBLE,
|
||||
"failure": "ignore",
|
||||
"environment": {
|
||||
"CONTINUOUS_DEPLOY_SERVERS_CONFIG": "../%s" % config,
|
||||
"CONTINUOUS_DEPLOY_SERVERS_CONFIG": "../%s" % (config),
|
||||
"REBUILD": rebuild,
|
||||
"HCLOUD_API_TOKEN": {
|
||||
"from_secret": "hcloud_api_token",
|
||||
@@ -2345,7 +2421,7 @@ def genericCache(name, action, mounts, cache_path):
|
||||
"secret_key": {
|
||||
"from_secret": "cache_s3_secret_key",
|
||||
},
|
||||
"filename": "%s.tar" % name,
|
||||
"filename": "%s.tar" % (name),
|
||||
"path": cache_path,
|
||||
"fallback_path": cache_path,
|
||||
},
|
||||
@@ -2390,7 +2466,7 @@ def genericCachePurge(flush_path):
|
||||
def genericBuildArtifactCache(ctx, name, action, path):
|
||||
if action == "rebuild" or action == "restore":
|
||||
cache_path = "%s/%s/%s" % ("cache", repo_slug, ctx.build.commit + "-${CI_PIPELINE_NUMBER}")
|
||||
name = "%s_build_artifact_cache" % name
|
||||
name = "%s_build_artifact_cache" % (name)
|
||||
return genericCache(name, action, [path], cache_path)
|
||||
|
||||
if action == "purge":
|
||||
@@ -2407,13 +2483,14 @@ def rebuildBuildArtifactCache(ctx, name, path):
|
||||
def purgeBuildArtifactCache(ctx):
|
||||
return genericBuildArtifactCache(ctx, "", "purge", [])
|
||||
|
||||
def pipelineSanityChecks(pipelines):
|
||||
def pipelineSanityChecks(ctx, pipelines):
|
||||
"""pipelineSanityChecks helps the CI developers to find errors before running it
|
||||
|
||||
These sanity checks are only executed on when converting starlark to yaml.
|
||||
Error outputs are only visible when the conversion is done with the woodpecker cli.
|
||||
|
||||
Args:
|
||||
ctx: woodpecker passes a context with information which the pipeline can be adapted to
|
||||
pipelines: pipelines to be checked, normally you should run this on the return value of main()
|
||||
|
||||
Returns:
|
||||
@@ -2425,7 +2502,7 @@ def pipelineSanityChecks(pipelines):
|
||||
for pipeline in pipelines:
|
||||
pipeline_name = pipeline["name"]
|
||||
if len(pipeline_name) > max_name_length:
|
||||
print("Error: pipeline name %s is longer than 50 characters" % pipeline_name)
|
||||
print("Error: pipeline name %s is longer than 50 characters" % (pipeline_name))
|
||||
|
||||
for step in pipeline["steps"]:
|
||||
step_name = step["name"]
|
||||
@@ -2476,7 +2553,7 @@ def pipelineSanityChecks(pipelines):
|
||||
def litmus(ctx, storage):
|
||||
pipelines = []
|
||||
|
||||
if not config["litmus"]:
|
||||
if (config["litmus"] == False):
|
||||
return pipelines
|
||||
|
||||
environment = {
|
||||
@@ -2993,6 +3070,7 @@ def onlyofficeService():
|
||||
"mkdir -p /var/www/onlyoffice/Data/certs",
|
||||
"cp onlyoffice.key /var/www/onlyoffice/Data/certs/",
|
||||
"cp onlyoffice.crt /var/www/onlyoffice/Data/certs/",
|
||||
"ls -al /var/www/onlyoffice/Data/certs/",
|
||||
"chmod 400 /var/www/onlyoffice/Data/certs/onlyoffice.key",
|
||||
"/app/ds/run-document-server.sh",
|
||||
],
|
||||
|
||||
106
CHANGELOG.md
106
CHANGELOG.md
@@ -1,106 +1,2 @@
|
||||
# Changelog
|
||||
# Table of Contents
|
||||
|
||||
## [2.1.0](https://github.com/opencloud-eu/opencloud/releases/tag/v2.1.0) - 2025-04-07
|
||||
|
||||
### ❤️ Thanks to all contributors! ❤️
|
||||
|
||||
@AlexAndBear, @JammingBen, @ScharfViktor, @aduffeck, @butonic, @fschade, @individual-it, @kulmann, @micbar, @michaelstingl, @rhafer
|
||||
|
||||
### 🐛 Bug Fixes
|
||||
|
||||
- feat(antivirus): add partial scanning mode [[#559](https://github.com/opencloud-eu/opencloud/pull/559)]
|
||||
- Simplify item-trashed SSEs. Also fixes it for coll. posix fs. [[#565](https://github.com/opencloud-eu/opencloud/pull/565)]
|
||||
- fix(opencloud_full): add missing SMTP env vars [[#563](https://github.com/opencloud-eu/opencloud/pull/563)]
|
||||
- fix: full deployment tika description is wrong [[#553](https://github.com/opencloud-eu/opencloud/pull/553)]
|
||||
- fix: traefik credentials [[#555](https://github.com/opencloud-eu/opencloud/pull/555)]
|
||||
- Enable scan/watch in the storageprovider only [[#546](https://github.com/opencloud-eu/opencloud/pull/546)]
|
||||
- fix: typo in dev docs [[#540](https://github.com/opencloud-eu/opencloud/pull/540)]
|
||||
|
||||
### 📈 Enhancement
|
||||
|
||||
- [full-ci] reva bump 2.31.0 [[#599](https://github.com/opencloud-eu/opencloud/pull/599)]
|
||||
- feat: support svg as icon [[#538](https://github.com/opencloud-eu/opencloud/pull/538)]
|
||||
- feat: change theme.json primary color [[#536](https://github.com/opencloud-eu/opencloud/pull/536)]
|
||||
- graph: reduce memory allocations [[#494](https://github.com/opencloud-eu/opencloud/pull/494)]
|
||||
|
||||
### ✅ Tests
|
||||
|
||||
- [full-ci] fix expected spanish string in test [[#596](https://github.com/opencloud-eu/opencloud/pull/596)]
|
||||
- Revert "Disable the 'exclude' patterns on the path conditional for now" [[#561](https://github.com/opencloud-eu/opencloud/pull/561)]
|
||||
|
||||
### 📦️ Dependencies
|
||||
|
||||
- build(deps): bump github.com/go-playground/validator/v10 from 10.25.0 to 10.26.0 [[#571](https://github.com/opencloud-eu/opencloud/pull/571)]
|
||||
- build(deps): bump github.com/nats-io/nats.go from 1.39.1 to 1.41.0 [[#567](https://github.com/opencloud-eu/opencloud/pull/567)]
|
||||
- [full-ci] chore(web): bump web to v2.2.0 [[#570](https://github.com/opencloud-eu/opencloud/pull/570)]
|
||||
- build(deps): bump github.com/onsi/gomega from 1.36.3 to 1.37.0 [[#566](https://github.com/opencloud-eu/opencloud/pull/566)]
|
||||
- build(deps): bump golang.org/x/net from 0.37.0 to 0.38.0 [[#557](https://github.com/opencloud-eu/opencloud/pull/557)]
|
||||
- build(deps-dev): bump eslint-plugin-jsx-a11y from 6.9.0 to 6.10.2 in /services/idp [[#542](https://github.com/opencloud-eu/opencloud/pull/542)]
|
||||
- build(deps): bump web-vitals from 3.5.2 to 4.2.4 in /services/idp [[#541](https://github.com/opencloud-eu/opencloud/pull/541)]
|
||||
- build(deps): bump github.com/open-policy-agent/opa from 1.2.0 to 1.3.0 [[#508](https://github.com/opencloud-eu/opencloud/pull/508)]
|
||||
- build(deps): bump github.com/urfave/cli/v2 from 2.27.5 to 2.27.6 [[#509](https://github.com/opencloud-eu/opencloud/pull/509)]
|
||||
- fix keycloak example #465 [[#535](https://github.com/opencloud-eu/opencloud/pull/535)]
|
||||
|
||||
## [2.0.0](https://github.com/opencloud-eu/opencloud/releases/tag/v2.0.0) - 2025-03-26
|
||||
|
||||
### ❤️ Thanks to all contributors! ❤️
|
||||
|
||||
@JammingBen, @ScharfViktor, @aduffeck, @amrita-shrestha, @butonic, @dragonchaser, @dragotin, @individual-it, @kulmann, @micbar, @prashant-gurung899, @rhafer
|
||||
|
||||
### 💥 Breaking changes
|
||||
|
||||
- [posix] change storage users default to posixfs [[#237](https://github.com/opencloud-eu/opencloud/pull/237)]
|
||||
|
||||
### 🐛 Bug Fixes
|
||||
|
||||
- Bump reva to 2.29.1 [[#501](https://github.com/opencloud-eu/opencloud/pull/501)]
|
||||
- remove workaround for translation formatting [[#491](https://github.com/opencloud-eu/opencloud/pull/491)]
|
||||
- [full-ci] fix(collaboration): hide SaveAs and ExportAs buttons in web office [[#471](https://github.com/opencloud-eu/opencloud/pull/471)]
|
||||
- fix: add missing debug docker [[#481](https://github.com/opencloud-eu/opencloud/pull/481)]
|
||||
- Downgrade nats.go to 1.39.1 [[#479](https://github.com/opencloud-eu/opencloud/pull/479)]
|
||||
- fix cli driver initialization for "posix" [[#459](https://github.com/opencloud-eu/opencloud/pull/459)]
|
||||
- Do not cache when there was an error gathering the data [[#462](https://github.com/opencloud-eu/opencloud/pull/462)]
|
||||
- fix(storage-users): 'uploads sessions' command crash [[#446](https://github.com/opencloud-eu/opencloud/pull/446)]
|
||||
- fix: org name in multiarch dev build [[#431](https://github.com/opencloud-eu/opencloud/pull/431)]
|
||||
- fix local setup [[#440](https://github.com/opencloud-eu/opencloud/pull/440)]
|
||||
|
||||
### 📈 Enhancement
|
||||
|
||||
- [full-ci] chore(web): update web to v2.1.0 [[#497](https://github.com/opencloud-eu/opencloud/pull/497)]
|
||||
- Bump reva [[#474](https://github.com/opencloud-eu/opencloud/pull/474)]
|
||||
- Bump reva to pull in the latest fixes [[#451](https://github.com/opencloud-eu/opencloud/pull/451)]
|
||||
- Switch to jsoncs3 backend for app tokens and enable service by default [[#433](https://github.com/opencloud-eu/opencloud/pull/433)]
|
||||
- Completely remove "edition" from capabilities [[#434](https://github.com/opencloud-eu/opencloud/pull/434)]
|
||||
- feat: add post logout redirect uris for mobile clients [[#411](https://github.com/opencloud-eu/opencloud/pull/411)]
|
||||
- chore: bump version to v1.1.0 [[#422](https://github.com/opencloud-eu/opencloud/pull/422)]
|
||||
|
||||
### ✅ Tests
|
||||
|
||||
- [full-ci] add one more TUS test to expected to fail file [[#489](https://github.com/opencloud-eu/opencloud/pull/489)]
|
||||
- [full-ci]Remove mtime 500 issue from expected failure [[#467](https://github.com/opencloud-eu/opencloud/pull/467)]
|
||||
- add auth app to ocm test setup [[#472](https://github.com/opencloud-eu/opencloud/pull/472)]
|
||||
- use opencloudeu/cs3api-validator in CI [[#469](https://github.com/opencloud-eu/opencloud/pull/469)]
|
||||
- fix(test): Run app-auth test with jsoncs3 backend [[#460](https://github.com/opencloud-eu/opencloud/pull/460)]
|
||||
- Always run CLI tests with the decomposed storage driver [[#435](https://github.com/opencloud-eu/opencloud/pull/435)]
|
||||
- Disable the 'exclude' patterns on the path conditional for now [[#439](https://github.com/opencloud-eu/opencloud/pull/439)]
|
||||
- run CS3 API tests in CI [[#415](https://github.com/opencloud-eu/opencloud/pull/415)]
|
||||
- fix: fix path exclusion glob patterns [[#427](https://github.com/opencloud-eu/opencloud/pull/427)]
|
||||
- Cleanup woodpecker [[#430](https://github.com/opencloud-eu/opencloud/pull/430)]
|
||||
- enable main API test suite to run in CI [[#419](https://github.com/opencloud-eu/opencloud/pull/419)]
|
||||
- Run wopi tests in CI [[#416](https://github.com/opencloud-eu/opencloud/pull/416)]
|
||||
- Run `cliCommands` tests pipeline in CI [[#413](https://github.com/opencloud-eu/opencloud/pull/413)]
|
||||
|
||||
### 📚 Documentation
|
||||
|
||||
- docs(idp): Document how to add custom OIDC clients [[#476](https://github.com/opencloud-eu/opencloud/pull/476)]
|
||||
- Clean invalid documentation links [[#466](https://github.com/opencloud-eu/opencloud/pull/466)]
|
||||
|
||||
### 📦️ Dependencies
|
||||
|
||||
- build(deps): bump github.com/grpc-ecosystem/grpc-gateway/v2 from 2.26.1 to 2.26.3 [[#480](https://github.com/opencloud-eu/opencloud/pull/480)]
|
||||
- chore: update alpine to 3.21 [[#483](https://github.com/opencloud-eu/opencloud/pull/483)]
|
||||
- build(deps): bump github.com/nats-io/nats.go from 1.39.1 to 1.40.0 [[#464](https://github.com/opencloud-eu/opencloud/pull/464)]
|
||||
- build(deps): bump github.com/spf13/afero from 1.12.0 to 1.14.0 [[#436](https://github.com/opencloud-eu/opencloud/pull/436)]
|
||||
- build(deps): bump github.com/KimMachineGun/automemlimit from 0.7.0 to 0.7.1 [[#437](https://github.com/opencloud-eu/opencloud/pull/437)]
|
||||
- build(deps): bump golang.org/x/image from 0.24.0 to 0.25.0 [[#426](https://github.com/opencloud-eu/opencloud/pull/426)]
|
||||
- build(deps): bump go.opentelemetry.io/contrib/zpages from 0.57.0 to 0.60.0 [[#425](https://github.com/opencloud-eu/opencloud/pull/425)]
|
||||
|
||||
@@ -31,9 +31,9 @@ to download. If not set, there is a reasonable default.
|
||||
Call
|
||||
|
||||
```
|
||||
OC_VERSION="2.0.0" ./install.sh
|
||||
OC_VERSION="1.0.0" ./install.sh
|
||||
```
|
||||
to install the OpenCloud version 2.0.0
|
||||
to install the OpenCloud version 1.0.0
|
||||
|
||||
There is also a hosted version of this script that makes it even
|
||||
easier:
|
||||
|
||||
@@ -37,7 +37,7 @@ function backup_file () {
|
||||
# URL pattern of the download file
|
||||
# https://github.com/opencloud-eu/opencloud/releases/download/v1.0.0/opencloud-1.0.0-linux-amd64
|
||||
|
||||
dlversion="${OC_VERSION:-2.0.0}"
|
||||
dlversion="${OC_VERSION:-1.1.0}"
|
||||
dlurl="https://github.com/opencloud-eu/opencloud/releases/download/v${dlversion}/"
|
||||
|
||||
sandbox="opencloud-sandbox-${dlversion}"
|
||||
|
||||
@@ -17,9 +17,7 @@ TRAEFIK_DASHBOARD=
|
||||
# Defaults to "traefik.opencloud.test"
|
||||
TRAEFIK_DOMAIN=
|
||||
# Basic authentication for the traefik dashboard.
|
||||
# Defaults to user "admin" and password "admin" (written as: "admin:$2y$05$KDHu3xq92SPaO3G8Ybkc7edd51pPLJcG1nWk3lmlrIdANQ/B6r5pq").
|
||||
# To create user:password pair, it's possible to use this command:
|
||||
# echo $(htpasswd -nB user) | sed -e s/\\$/\\$\\$/g
|
||||
# Defaults to user "admin" and password "admin" (written as: "admin:admin").
|
||||
TRAEFIK_BASIC_AUTH_USERS=
|
||||
# Email address for obtaining LetsEncrypt certificates.
|
||||
# Needs only be changed if this is a public facing server.
|
||||
@@ -94,14 +92,15 @@ DECOMPOSEDS3_BUCKET=
|
||||
# Minio domain. Defaults to "minio.opencloud.test".
|
||||
MINIO_DOMAIN=
|
||||
|
||||
# OpenCloud uses POSIX storage as the default primary storage.
|
||||
# By default, Decomposed storage is disabled, and the POSIX storage driver is used.
|
||||
# To enable Decomposed storage, uncomment the following line.
|
||||
# POSIX Storage configuration - optional
|
||||
# OpenCloud supports posix storage as primary storage.
|
||||
# Per default, S3 storage is disabled and the decomposed storage driver is used.
|
||||
# To enable POSIX storage, uncomment the following line.
|
||||
# Note: the leading colon is required to enable the service.
|
||||
#DECOMPOSED=:decomposed.yml
|
||||
#POSIX=:posix.yml
|
||||
|
||||
# Define SMTP settings if you would like to send OpenCloud email notifications.
|
||||
#
|
||||
# Define SMPT settings if you would like to send OpenCloud email notifications.
|
||||
#
|
||||
# NOTE: when configuring Inbucket, these settings have no effect, see inbucket.yml for details.
|
||||
# SMTP host to connect to.
|
||||
SMTP_HOST=
|
||||
@@ -116,8 +115,6 @@ SMTP_USERNAME=
|
||||
SMTP_PASSWORD=
|
||||
# Authentication method for the SMTP communication.
|
||||
SMTP_AUTHENTICATION=
|
||||
# Encryption method for the SMTP communication. Possible values are 'starttls', 'ssltls' and 'none'
|
||||
SMTP_TRANSPORT_ENCRYPTION=
|
||||
# Allow insecure connections to the SMTP server. Defaults to false.
|
||||
SMTP_INSECURE=
|
||||
|
||||
@@ -161,7 +158,7 @@ COMPANION_ONEDRIVE_SECRET=
|
||||
## Default Enabled Services ##
|
||||
|
||||
### Apache Tika Content Analysis Toolkit ###
|
||||
# Tika (search) is disabled by default due to performance reasons.
|
||||
# Tika (search) is enabled by default, comment if not required.
|
||||
# Note: the leading colon is required to enable the service.
|
||||
#TIKA=:tika.yml
|
||||
# Set the desired docker image tag or digest.
|
||||
@@ -214,13 +211,6 @@ COLLABORA_SSL_VERIFICATION=false
|
||||
# envvar in the OpenCloud Settings above by adding 'antivirus' to the list.
|
||||
# Note: the leading colon is required to enable the service.
|
||||
#CLAMAV=:clamav.yml
|
||||
# The maximum scan size the virus scanner can handle, needs adjustment in the scanner config as well.
|
||||
# Usable common abbreviations: [KB, KiB, MB, MiB, GB, GiB, TB, TiB, PB, PiB, EB, EiB], example: 2GB.
|
||||
# Defaults to "100MB"
|
||||
#ANTIVIRUS_MAX_SCAN_SIZE=
|
||||
# Usable modes: partial, skip.
|
||||
# Defaults to "partial"
|
||||
#ANTIVIRUS_MAX_SCAN_SIZE_MODE=
|
||||
# Image version of the ClamAV container.
|
||||
# Defaults to "latest"
|
||||
CLAMAV_DOCKER_TAG=
|
||||
@@ -248,20 +238,8 @@ INBUCKET_DOMAIN=
|
||||
# Path separator for supplemental compose files specified in COMPOSE_FILE.
|
||||
COMPOSE_PATH_SEPARATOR=:
|
||||
|
||||
### Keycloak Settings ###
|
||||
# Note: the leading colon is required to enable the service.
|
||||
#KEYCLOAK=:keycloak.yml
|
||||
# Domain for Keycloak. Defaults to "keycloak.opencloud.test".
|
||||
KEYCLOAK_DOMAIN=
|
||||
# Realm which to be used with OpenCloud. Defaults to "OpenCloud"
|
||||
KEYCLOAK_REALM=
|
||||
# Admin user login name. Defaults to "admin"
|
||||
KEYCLOAK_ADMIN_USER=
|
||||
# Admin user login password. Defaults to "admin"
|
||||
KEYCLOAK_ADMIN_PASSWORD=
|
||||
|
||||
## IMPORTANT ##
|
||||
# This MUST be the last line as it assembles the supplemental compose files to be used.
|
||||
# ALL supplemental configs must be added here, whether commented or not.
|
||||
# Each var must either be empty or contain :path/file.yml
|
||||
COMPOSE_FILE=docker-compose.yml${OPENCLOUD:-}${TIKA:-}${DECOMPOSEDS3:-}${DECOMPOSEDS3_MINIO:-}${DECOMPOSED:-}${COLLABORA:-}${MONITORING:-}${IMPORTER:-}${CLAMAV:-}${ONLYOFFICE:-}${INBUCKET:-}${EXTENSIONS:-}${UNZIP:-}${DRAWIO:-}${JSONVIEWER:-}${PROGRESSBARS:-}${EXTERNALSITES:-}${KEYCLOAK:-}
|
||||
COMPOSE_FILE=docker-compose.yml${OPENCLOUD:-}${TIKA:-}${DECOMPOSEDS3:-}${DECOMPOSEDS3_MINIO:-}${POSIX:-}${COLLABORA:-}${MONITORING:-}${IMPORTER:-}${CLAMAV:-}${ONLYOFFICE:-}${INBUCKET:-}${EXTENSIONS:-}${UNZIP:-}${DRAWIO:-}${JSONVIEWER:-}${PROGRESSBARS:-}${EXTERNALSITES:-}
|
||||
|
||||
@@ -4,8 +4,6 @@ services:
|
||||
environment:
|
||||
ANTIVIRUS_SCANNER_TYPE: "clamav"
|
||||
ANTIVIRUS_CLAMAV_SOCKET: "/var/run/clamav/clamd.sock"
|
||||
ANTIVIRUS_MAX_SCAN_SIZE_MODE: ${ANTIVIRUS_MAX_SCAN_SIZE_MODE:-partial}
|
||||
ANTIVIRUS_MAX_SCAN_SIZE: ${ANTIVIRUS_MAX_SCAN_SIZE:-100MB}
|
||||
# the antivirus service needs manual startup, see .env and opencloud.yaml for START_ADDITIONAL_SERVICES
|
||||
# configure the antivirus service
|
||||
POSTPROCESSING_STEPS: "virusscan"
|
||||
|
||||
@@ -1,63 +0,0 @@
|
||||
{
|
||||
"clientId": "OpenCloudAndroid",
|
||||
"name": "OpenCloud Android App",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"oc://android.opencloud.eu"
|
||||
],
|
||||
"webOrigins": [],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"post.logout.redirect.uris": "oc://android.opencloud.eu",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -1,64 +0,0 @@
|
||||
{
|
||||
"clientId": "OpenCloudDesktop",
|
||||
"name": "OpenCloud Desktop Client",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"http://127.0.0.1",
|
||||
"http://localhost"
|
||||
],
|
||||
"webOrigins": [],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"post.logout.redirect.uris": "+",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -1,63 +0,0 @@
|
||||
{
|
||||
"clientId": "OpenCloudIOS",
|
||||
"name": "OpenCloud iOS App",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"oc://ios.opencloud.eu"
|
||||
],
|
||||
"webOrigins": [],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"post.logout.redirect.uris": "oc://ios.opencloud.eu",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -1,66 +0,0 @@
|
||||
{
|
||||
"clientId": "Cyberduck",
|
||||
"name": "Cyberduck",
|
||||
"description": "File transfer utility client",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"x-cyberduck-action:oauth",
|
||||
"x-mountainduck-action:oauth"
|
||||
],
|
||||
"webOrigins": [],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"oauth2.device.authorization.grant.enabled": "false",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"oidc.ciba.grant.enabled": "false",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -1,74 +0,0 @@
|
||||
{
|
||||
"clientId": "web",
|
||||
"name": "OpenCloud Web App",
|
||||
"description": "",
|
||||
"rootUrl": "{{OC_URL}}",
|
||||
"adminUrl": "{{OC_URL}}",
|
||||
"baseUrl": "",
|
||||
"surrogateAuthRequired": false,
|
||||
"enabled": true,
|
||||
"alwaysDisplayInConsole": false,
|
||||
"clientAuthenticatorType": "client-secret",
|
||||
"redirectUris": [
|
||||
"{{OC_URL}}/",
|
||||
"{{OC_URL}}/oidc-callback.html",
|
||||
"{{OC_URL}}/oidc-silent-redirect.html"
|
||||
],
|
||||
"webOrigins": [
|
||||
"{{OC_URL}}"
|
||||
],
|
||||
"notBefore": 0,
|
||||
"bearerOnly": false,
|
||||
"consentRequired": false,
|
||||
"standardFlowEnabled": true,
|
||||
"implicitFlowEnabled": false,
|
||||
"directAccessGrantsEnabled": true,
|
||||
"serviceAccountsEnabled": false,
|
||||
"publicClient": true,
|
||||
"frontchannelLogout": false,
|
||||
"protocol": "openid-connect",
|
||||
"attributes": {
|
||||
"saml.assertion.signature": "false",
|
||||
"saml.force.post.binding": "false",
|
||||
"saml.multivalued.roles": "false",
|
||||
"saml.encrypt": "false",
|
||||
"post.logout.redirect.uris": "+",
|
||||
"oauth2.device.authorization.grant.enabled": "false",
|
||||
"backchannel.logout.revoke.offline.tokens": "false",
|
||||
"saml.server.signature": "false",
|
||||
"saml.server.signature.keyinfo.ext": "false",
|
||||
"exclude.session.state.from.auth.response": "false",
|
||||
"oidc.ciba.grant.enabled": "false",
|
||||
"backchannel.logout.url": "{{OC_URL}}/backchannel_logout",
|
||||
"backchannel.logout.session.required": "true",
|
||||
"client_credentials.use_refresh_token": "false",
|
||||
"saml_force_name_id_format": "false",
|
||||
"saml.client.signature": "false",
|
||||
"tls.client.certificate.bound.access.tokens": "false",
|
||||
"saml.authnstatement": "false",
|
||||
"display.on.consent.screen": "false",
|
||||
"saml.onetimeuse.condition": "false"
|
||||
},
|
||||
"authenticationFlowBindingOverrides": {},
|
||||
"fullScopeAllowed": true,
|
||||
"nodeReRegistrationTimeout": -1,
|
||||
"defaultClientScopes": [
|
||||
"web-origins",
|
||||
"profile",
|
||||
"roles",
|
||||
"groups",
|
||||
"basic",
|
||||
"email"
|
||||
],
|
||||
"optionalClientScopes": [
|
||||
"address",
|
||||
"phone",
|
||||
"offline_access",
|
||||
"microprofile-jwt"
|
||||
],
|
||||
"access": {
|
||||
"view": true,
|
||||
"configure": true,
|
||||
"manage": true
|
||||
}
|
||||
}
|
||||
@@ -1,8 +0,0 @@
|
||||
#!/bin/bash
|
||||
printenv
|
||||
# replace openCloud domain in keycloak realm import
|
||||
mkdir /opt/keycloak/data/import
|
||||
sed -e "s/cloud.opencloud.test/${OC_DOMAIN}/g" /opt/keycloak/data/import-dist/opencloud-realm.json > /opt/keycloak/data/import/opencloud-realm.json
|
||||
|
||||
# run original docker-entrypoint
|
||||
/opt/keycloak/bin/kc.sh "$@"
|
||||
File diff suppressed because it is too large
Load Diff
@@ -7,7 +7,6 @@ directives:
|
||||
- 'https://${COMPANION_DOMAIN|companion.opencloud.test}/'
|
||||
- 'wss://${COMPANION_DOMAIN|companion.opencloud.test}/'
|
||||
- 'https://raw.githubusercontent.com/opencloud-eu/awesome-apps/'
|
||||
- 'https://${KEYCLOAK_DOMAIN|keycloak.opencloud.test}/'
|
||||
default-src:
|
||||
- '''none'''
|
||||
font-src:
|
||||
|
||||
@@ -1,6 +0,0 @@
|
||||
---
|
||||
services:
|
||||
opencloud:
|
||||
environment:
|
||||
STORAGE_USERS_DRIVER: decomposed
|
||||
|
||||
@@ -1,73 +0,0 @@
|
||||
---
|
||||
services:
|
||||
traefik:
|
||||
networks:
|
||||
opencloud-net:
|
||||
aliases:
|
||||
- ${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}
|
||||
|
||||
opencloud:
|
||||
environment:
|
||||
# Keycloak IDP specific configuration
|
||||
PROXY_AUTOPROVISION_ACCOUNTS: "true"
|
||||
PROXY_ROLE_ASSIGNMENT_DRIVER: "oidc"
|
||||
OC_OIDC_ISSUER: https://${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}/realms/${KEYCLOAK_REALM:-openCloud}
|
||||
PROXY_OIDC_REWRITE_WELLKNOWN: "true"
|
||||
WEB_OIDC_CLIENT_ID: ${OC_OIDC_CLIENT_ID:-web}
|
||||
|
||||
PROXY_USER_OIDC_CLAIM: "preferred_username"
|
||||
PROXY_USER_CS3_CLAIM: "username"
|
||||
OC_EXCLUDE_RUN_SERVICES: "idp"
|
||||
OC_ADMIN_USER_ID: ""
|
||||
GRAPH_ASSIGN_DEFAULT_USER_ROLE: "false"
|
||||
GRAPH_USERNAME_MATCH: "none"
|
||||
KEYCLOAK_DOMAIN: ${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}
|
||||
|
||||
postgres:
|
||||
image: postgres:alpine
|
||||
networks:
|
||||
opencloud-net:
|
||||
volumes:
|
||||
- keycloak_postgres_data:/var/lib/postgresql/data
|
||||
environment:
|
||||
POSTGRES_DB: keycloak
|
||||
POSTGRES_USER: keycloak
|
||||
POSTGRES_PASSWORD: keycloak
|
||||
logging:
|
||||
driver: ${LOG_DRIVER:-local}
|
||||
restart: always
|
||||
|
||||
keycloak:
|
||||
image: quay.io/keycloak/keycloak:25.0.0
|
||||
networks:
|
||||
opencloud-net:
|
||||
command: ["start", "--proxy=edge", "--spi-connections-http-client-default-disable-trust-manager=${INSECURE:-false}", "--import-realm"]
|
||||
entrypoint: ["/bin/sh", "/opt/keycloak/bin/docker-entrypoint-override.sh"]
|
||||
volumes:
|
||||
- "./config/keycloak/docker-entrypoint-override.sh:/opt/keycloak/bin/docker-entrypoint-override.sh"
|
||||
- "./config/keycloak/opencloud-realm.dist.json:/opt/keycloak/data/import-dist/opencloud-realm.json"
|
||||
environment:
|
||||
OC_DOMAIN: ${OC_DOMAIN:-cloud.opencloud.test}
|
||||
KC_HOSTNAME: ${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}
|
||||
KC_DB: postgres
|
||||
KC_DB_URL: "jdbc:postgresql://postgres:5432/keycloak"
|
||||
KC_DB_USERNAME: keycloak
|
||||
KC_DB_PASSWORD: keycloak
|
||||
KC_FEATURES: impersonation
|
||||
KEYCLOAK_ADMIN: ${KEYCLOAK_ADMIN_USER:-admin}
|
||||
KEYCLOAK_ADMIN_PASSWORD: ${KEYCLOAK_ADMIN_PASSWORD:-admin}
|
||||
labels:
|
||||
- "traefik.enable=true"
|
||||
- "traefik.http.routers.keycloak.entrypoints=https"
|
||||
- "traefik.http.routers.keycloak.rule=Host(`${KEYCLOAK_DOMAIN:-keycloak.opencloud.test}`)"
|
||||
- "traefik.http.routers.keycloak.tls.certresolver=http"
|
||||
- "traefik.http.routers.keycloak.service=keycloak"
|
||||
- "traefik.http.services.keycloak.loadbalancer.server.port=8080"
|
||||
depends_on:
|
||||
- postgres
|
||||
logging:
|
||||
driver: ${LOG_DRIVER:-local}
|
||||
restart: always
|
||||
|
||||
volumes:
|
||||
keycloak_postgres_data:
|
||||
@@ -41,10 +41,7 @@ services:
|
||||
NOTIFICATIONS_SMTP_PORT: "${SMTP_PORT}"
|
||||
NOTIFICATIONS_SMTP_SENDER: "${SMTP_SENDER:-OpenCloud notifications <notifications@${OC_DOMAIN:-cloud.opencloud.test}>}"
|
||||
NOTIFICATIONS_SMTP_USERNAME: "${SMTP_USERNAME}"
|
||||
NOTIFICATIONS_SMTP_PASSWORD: "${SMTP_PASSWORD}"
|
||||
NOTIFICATIONS_SMTP_INSECURE: "${SMTP_INSECURE}"
|
||||
NOTIFICATIONS_SMTP_AUTHENTICATION: "${SMTP_AUTHENTICATION}"
|
||||
NOTIFICATIONS_SMTP_ENCRYPTION: "${SMTP_TRANSPORT_ENCRYPTION}"
|
||||
# make the registry available to the app provider containers
|
||||
MICRO_REGISTRY_ADDRESS: 127.0.0.1:9233
|
||||
NATS_NATS_HOST: 0.0.0.0
|
||||
|
||||
10
deployments/examples/opencloud_full/posix.yml
Normal file
10
deployments/examples/opencloud_full/posix.yml
Normal file
@@ -0,0 +1,10 @@
|
||||
---
|
||||
services:
|
||||
opencloud:
|
||||
environment:
|
||||
# activate posix storage driver for users
|
||||
STORAGE_USERS_DRIVER: posix
|
||||
# keep system data on decomposed storage since this are only small files atm
|
||||
STORAGE_SYSTEM_DRIVER: decomposed
|
||||
# posix requires a shared cache store
|
||||
STORAGE_USERS_ID_CACHE_STORE: "nats-js-kv"
|
||||
@@ -6,10 +6,12 @@ services:
|
||||
condition: service_completed_successfully
|
||||
|
||||
unzip-init:
|
||||
image: opencloudeu/web-extensions:unzip-1.0.2
|
||||
image: opencloudeu/web-extensions:unzip-1.0.0
|
||||
user: root
|
||||
volumes:
|
||||
- opencloud-apps:/apps
|
||||
entrypoint:
|
||||
- /bin/sh
|
||||
command: ["-c", "cp -R /usr/share/nginx/html/unzip/ /apps"]
|
||||
|
||||
|
||||
|
||||
@@ -13,5 +13,5 @@ Please be patient, we are working on the content.
|
||||
|
||||
If you want to contribute to the dev docs, please visit [OpenCloud on Github](https://github.com/opencloud-eu/).
|
||||
|
||||
Contents will be transferred during the build process.
|
||||
Contents will be transferred, during the build process.
|
||||
|
||||
|
||||
30
go.mod
30
go.mod
@@ -33,7 +33,7 @@ require (
|
||||
github.com/go-micro/plugins/v4/store/nats-js-kv v0.0.0-20240726082623-6831adfdcdc4
|
||||
github.com/go-micro/plugins/v4/wrapper/monitoring/prometheus v1.2.0
|
||||
github.com/go-micro/plugins/v4/wrapper/trace/opentelemetry v1.2.0
|
||||
github.com/go-playground/validator/v10 v10.26.0
|
||||
github.com/go-playground/validator/v10 v10.25.0
|
||||
github.com/gofrs/uuid v4.4.0+incompatible
|
||||
github.com/golang-jwt/jwt/v5 v5.2.2
|
||||
github.com/golang/protobuf v1.5.4
|
||||
@@ -56,14 +56,14 @@ require (
|
||||
github.com/mna/pigeon v1.3.0
|
||||
github.com/mohae/deepcopy v0.0.0-20170929034955-c48cc78d4826
|
||||
github.com/nats-io/nats-server/v2 v2.11.0
|
||||
github.com/nats-io/nats.go v1.41.0
|
||||
github.com/nats-io/nats.go v1.39.1
|
||||
github.com/oklog/run v1.1.0
|
||||
github.com/olekukonko/tablewriter v0.0.5
|
||||
github.com/onsi/ginkgo v1.16.5
|
||||
github.com/onsi/ginkgo/v2 v2.23.3
|
||||
github.com/onsi/gomega v1.37.0
|
||||
github.com/open-policy-agent/opa v1.3.0
|
||||
github.com/opencloud-eu/reva/v2 v2.31.0
|
||||
github.com/onsi/gomega v1.36.3
|
||||
github.com/open-policy-agent/opa v1.2.0
|
||||
github.com/opencloud-eu/reva/v2 v2.28.1-0.20250325103543-f3ec73475a58
|
||||
github.com/orcaman/concurrent-map v1.0.0
|
||||
github.com/owncloud/libre-graph-api-go v1.0.5-0.20240829135935-80dc00d6f5ea
|
||||
github.com/pkg/errors v0.9.1
|
||||
@@ -73,7 +73,7 @@ require (
|
||||
github.com/riandyrn/otelchi v0.12.1
|
||||
github.com/rogpeppe/go-internal v1.14.1
|
||||
github.com/rs/cors v1.11.1
|
||||
github.com/rs/zerolog v1.34.0
|
||||
github.com/rs/zerolog v1.33.0
|
||||
github.com/shamaton/msgpack/v2 v2.2.3
|
||||
github.com/sirupsen/logrus v1.9.3
|
||||
github.com/spf13/afero v1.14.0
|
||||
@@ -82,9 +82,9 @@ require (
|
||||
github.com/test-go/testify v1.1.4
|
||||
github.com/thejerf/suture/v4 v4.0.6
|
||||
github.com/tidwall/gjson v1.18.0
|
||||
github.com/tus/tusd/v2 v2.8.0
|
||||
github.com/tus/tusd/v2 v2.7.1
|
||||
github.com/unrolled/secure v1.16.0
|
||||
github.com/urfave/cli/v2 v2.27.6
|
||||
github.com/urfave/cli/v2 v2.27.5
|
||||
github.com/xhit/go-simple-mail/v2 v2.16.0
|
||||
go-micro.dev/v4 v4.11.0
|
||||
go.etcd.io/bbolt v1.4.0
|
||||
@@ -99,14 +99,14 @@ require (
|
||||
golang.org/x/crypto v0.36.0
|
||||
golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac
|
||||
golang.org/x/image v0.25.0
|
||||
golang.org/x/net v0.38.0
|
||||
golang.org/x/net v0.37.0
|
||||
golang.org/x/oauth2 v0.28.0
|
||||
golang.org/x/sync v0.12.0
|
||||
golang.org/x/term v0.30.0
|
||||
golang.org/x/text v0.23.0
|
||||
google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb
|
||||
google.golang.org/grpc v1.71.1
|
||||
google.golang.org/protobuf v1.36.6
|
||||
google.golang.org/grpc v1.71.0
|
||||
google.golang.org/protobuf v1.36.5
|
||||
gopkg.in/yaml.v2 v2.4.0
|
||||
gotest.tools/v3 v3.5.2
|
||||
stash.kopano.io/kgol/rndm v1.1.2
|
||||
@@ -237,7 +237,7 @@ require (
|
||||
github.com/juliangruber/go-intersect v1.1.0 // indirect
|
||||
github.com/kevinburke/ssh_config v1.2.0 // indirect
|
||||
github.com/klauspost/compress v1.18.0 // indirect
|
||||
github.com/klauspost/cpuid/v2 v2.2.10 // indirect
|
||||
github.com/klauspost/cpuid/v2 v2.2.9 // indirect
|
||||
github.com/leodido/go-urn v1.4.0 // indirect
|
||||
github.com/libregraph/oidc-go v1.1.0 // indirect
|
||||
github.com/longsleep/go-metrics v1.0.0 // indirect
|
||||
@@ -246,7 +246,7 @@ require (
|
||||
github.com/mattn/go-colorable v0.1.14 // indirect
|
||||
github.com/mattn/go-isatty v0.0.20 // indirect
|
||||
github.com/mattn/go-runewidth v0.0.16 // indirect
|
||||
github.com/mattn/go-sqlite3 v1.14.27 // indirect
|
||||
github.com/mattn/go-sqlite3 v1.14.24 // indirect
|
||||
github.com/maxymania/go-system v0.0.0-20170110133659-647cc364bf0b // indirect
|
||||
github.com/mendsley/gojwk v0.0.0-20141217222730-4d5ec6e58103 // indirect
|
||||
github.com/miekg/dns v1.1.57 // indirect
|
||||
@@ -254,7 +254,7 @@ require (
|
||||
github.com/minio/crc64nvme v1.0.1 // indirect
|
||||
github.com/minio/highwayhash v1.0.3 // indirect
|
||||
github.com/minio/md5-simd v1.1.2 // indirect
|
||||
github.com/minio/minio-go/v7 v7.0.89 // indirect
|
||||
github.com/minio/minio-go/v7 v7.0.88 // indirect
|
||||
github.com/mitchellh/copystructure v1.2.0 // indirect
|
||||
github.com/mitchellh/reflectwalk v1.0.2 // indirect
|
||||
github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect
|
||||
@@ -325,7 +325,7 @@ require (
|
||||
golang.org/x/time v0.11.0 // indirect
|
||||
golang.org/x/tools v0.31.0 // indirect
|
||||
golang.org/x/xerrors v0.0.0-20220907171357-04be3eba64a2 // indirect
|
||||
google.golang.org/genproto v0.0.0-20250303144028-a0af3efb3deb // indirect
|
||||
google.golang.org/genproto v0.0.0-20241118233622-e639e219e697 // indirect
|
||||
google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb // indirect
|
||||
gopkg.in/cenkalti/backoff.v1 v1.1.0 // indirect
|
||||
gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 // indirect
|
||||
|
||||
71
go.sum
71
go.sum
@@ -258,8 +258,8 @@ github.com/deckarep/golang-set v1.8.0/go.mod h1:5nI87KwE7wgsBU1F4GKAw2Qod7p5kyS3
|
||||
github.com/deepmap/oapi-codegen v1.3.11/go.mod h1:suMvK7+rKlx3+tpa8ByptmvoXbAV70wERKTOGH3hLp0=
|
||||
github.com/desertbit/timer v0.0.0-20180107155436-c41aec40b27f h1:U5y3Y5UE0w7amNe7Z5G/twsBW0KEalRQXZzf8ufSh9I=
|
||||
github.com/desertbit/timer v0.0.0-20180107155436-c41aec40b27f/go.mod h1:xH/i4TFMt8koVQZ6WFms69WAsDWr2XsYL3Hkl7jkoLE=
|
||||
github.com/dgraph-io/badger/v4 v4.6.0 h1:acOwfOOZ4p1dPRnYzvkVm7rUk2Y21TgPVepCy5dJdFQ=
|
||||
github.com/dgraph-io/badger/v4 v4.6.0/go.mod h1:KSJ5VTuZNC3Sd+YhvVjk2nYua9UZnnTr/SkXvdtiPgI=
|
||||
github.com/dgraph-io/badger/v4 v4.5.1 h1:7DCIXrQjo1LKmM96YD+hLVJ2EEsyyoWxJfpdd56HLps=
|
||||
github.com/dgraph-io/badger/v4 v4.5.1/go.mod h1:qn3Be0j3TfV4kPbVoK0arXCD1/nr1ftth6sbL5jxdoA=
|
||||
github.com/dgraph-io/ristretto v0.2.0 h1:XAfl+7cmoUDWW/2Lx8TGZQjjxIQ2Ley9DSf52dru4WE=
|
||||
github.com/dgraph-io/ristretto v0.2.0/go.mod h1:8uBHCU/PBV4Ag0CJrP47b9Ofby5dqWNh4FicAdoqFNU=
|
||||
github.com/dgraph-io/ristretto/v2 v2.1.0 h1:59LjpOJLNDULHh8MC4UaegN52lC4JnO2dITsie/Pa8I=
|
||||
@@ -411,8 +411,8 @@ github.com/go-playground/locales v0.14.1 h1:EWaQ/wswjilfKLTECiXz7Rh+3BjFhfDFKv/o
|
||||
github.com/go-playground/locales v0.14.1/go.mod h1:hxrqLVvrK65+Rwrd5Fc6F2O76J/NuW9t0sjnWqG1slY=
|
||||
github.com/go-playground/universal-translator v0.18.1 h1:Bcnm0ZwsGyWbCzImXv+pAJnYK9S473LQFuzCbDbfSFY=
|
||||
github.com/go-playground/universal-translator v0.18.1/go.mod h1:xekY+UJKNuX9WP91TpwSH2VMlDf28Uj24BCp08ZFTUY=
|
||||
github.com/go-playground/validator/v10 v10.26.0 h1:SP05Nqhjcvz81uJaRfEV0YBSSSGMc/iMaVtFbr3Sw2k=
|
||||
github.com/go-playground/validator/v10 v10.26.0/go.mod h1:I5QpIEbmr8On7W0TktmJAumgzX4CA1XNl4ZmDuVHKKo=
|
||||
github.com/go-playground/validator/v10 v10.25.0 h1:5Dh7cjvzR7BRZadnsVOzPhWsrwUr0nmsZJxEAnFLNO8=
|
||||
github.com/go-playground/validator/v10 v10.25.0/go.mod h1:GGzBIJMuE98Ic/kJsBXbz1x/7cByt++cQ+YOuDM5wus=
|
||||
github.com/go-redis/redis/v8 v8.11.5 h1:AcZZR7igkdvfVmQTPnu9WE37LRrO/YrBH5zWyjDC0oI=
|
||||
github.com/go-redis/redis/v8 v8.11.5/go.mod h1:gREzHqY1hg6oD9ngVRbLStwAWKhA0FEgq8Jd4h5lpwo=
|
||||
github.com/go-resty/resty/v2 v2.1.1-0.20191201195748-d7b97669fe48/go.mod h1:dZGr0i9PLlaaTD4H/hoZIDjQ+r6xq8mgbRzHZf7f2J8=
|
||||
@@ -504,8 +504,8 @@ github.com/gomodule/redigo v1.9.2 h1:HrutZBLhSIU8abiSfW8pj8mPhOyMYjZT/wcA4/L9L9s
|
||||
github.com/gomodule/redigo v1.9.2/go.mod h1:KsU3hiK/Ay8U42qpaJk+kuNa3C+spxapWpM+ywhcgtw=
|
||||
github.com/google/btree v0.0.0-20180813153112-4030bb1f1f0c/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ=
|
||||
github.com/google/btree v1.0.0/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ=
|
||||
github.com/google/flatbuffers v25.2.10+incompatible h1:F3vclr7C3HpB1k9mxCGRMXq6FdUalZ6H/pNX4FP1v0Q=
|
||||
github.com/google/flatbuffers v25.2.10+incompatible/go.mod h1:1AeVuKshWv4vARoZatz6mlQ0JxURH0Kv5+zNeJKJCa8=
|
||||
github.com/google/flatbuffers v24.12.23+incompatible h1:ubBKR94NR4pXUCY/MUsRVzd9umNW7ht7EG9hHfS9FX8=
|
||||
github.com/google/flatbuffers v24.12.23+incompatible/go.mod h1:1AeVuKshWv4vARoZatz6mlQ0JxURH0Kv5+zNeJKJCa8=
|
||||
github.com/google/go-cmp v0.2.0/go.mod h1:oXzfMopK8JAjlY9xF4vHSVASa0yLyX7SntLO5aqRK0M=
|
||||
github.com/google/go-cmp v0.3.0/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU=
|
||||
github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU=
|
||||
@@ -689,8 +689,8 @@ github.com/klauspost/compress v1.15.9/go.mod h1:PhcZ0MbTNciWF3rruxRgKxI5NkcHHrHU
|
||||
github.com/klauspost/compress v1.18.0 h1:c/Cqfb0r+Yi+JtIEq73FWXVkRonBlf0CRNYc8Zttxdo=
|
||||
github.com/klauspost/compress v1.18.0/go.mod h1:2Pp+KzxcywXVXMr50+X0Q/Lsb43OQHYWRCY2AiWywWQ=
|
||||
github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
|
||||
github.com/klauspost/cpuid/v2 v2.2.10 h1:tBs3QSyvjDyFTq3uoc/9xFpCuOsJQFNPiAhYdw2skhE=
|
||||
github.com/klauspost/cpuid/v2 v2.2.10/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0=
|
||||
github.com/klauspost/cpuid/v2 v2.2.9 h1:66ze0taIn2H33fBvCkXuv9BmCwDfafmiIVpKV9kKGuY=
|
||||
github.com/klauspost/cpuid/v2 v2.2.9/go.mod h1:rqkxqrZ1EhYM9G+hXH7YdowN5R5RGN6NK4QwQ3WMXF8=
|
||||
github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202 h1:A1xJ2NKgiYFiaHiLl9B5yw/gUBACSs9crDykTS3GuQI=
|
||||
github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202/go.mod h1:bHA7t77X/QFExdeAnDzK6vKM34kEZAcE1OX4MfiwjkE=
|
||||
github.com/kobergj/plugins/v4/store/nats-js-kv v0.0.0-20240807130109-f62bb67e8c90 h1:pfI8Z5yavO6fU6vDGlWhZ4BgDlvj8c6xB7J57HfTPwA=
|
||||
@@ -768,8 +768,8 @@ github.com/mattn/go-runewidth v0.0.6/go.mod h1:H031xJmbD/WCDINGzjvQ9THkh0rPKHF+m
|
||||
github.com/mattn/go-runewidth v0.0.9/go.mod h1:H031xJmbD/WCDINGzjvQ9THkh0rPKHF+m2gUSrubnMI=
|
||||
github.com/mattn/go-runewidth v0.0.16 h1:E5ScNMtiwvlvB5paMFdw9p4kSQzbXFikJ5SQO6TULQc=
|
||||
github.com/mattn/go-runewidth v0.0.16/go.mod h1:Jdepj2loyihRzMpdS35Xk/zdY8IAYHsh153qUoGf23w=
|
||||
github.com/mattn/go-sqlite3 v1.14.27 h1:drZCnuvf37yPfs95E5jd9s3XhdVWLal+6BOK6qrv6IU=
|
||||
github.com/mattn/go-sqlite3 v1.14.27/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
|
||||
github.com/mattn/go-sqlite3 v1.14.24 h1:tpSp2G2KyMnnQu99ngJ47EIkWVmliIizyZBfPrBWDRM=
|
||||
github.com/mattn/go-sqlite3 v1.14.24/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
|
||||
github.com/mattn/go-tty v0.0.0-20180219170247-931426f7535a/go.mod h1:XPvLUNfbS4fJH25nqRHfWLMa1ONC8Amw+mIA639KxkE=
|
||||
github.com/mattn/go-tty v0.0.3/go.mod h1:ihxohKRERHTVzN+aSVRwACLCeqIoZAWpoICkkvrWyR0=
|
||||
github.com/matttproud/golang_protobuf_extensions v1.0.1/go.mod h1:D8He9yQNgCq6Z5Ld7szi9bcBfOoFv/3dc6xSMkL2PC0=
|
||||
@@ -789,8 +789,8 @@ github.com/minio/highwayhash v1.0.3 h1:kbnuUMoHYyVl7szWjSxJnxw11k2U709jqFPPmIUyD
|
||||
github.com/minio/highwayhash v1.0.3/go.mod h1:GGYsuwP/fPD6Y9hMiXuapVvlIUEhFhMTh0rxU3ik1LQ=
|
||||
github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34=
|
||||
github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM=
|
||||
github.com/minio/minio-go/v7 v7.0.89 h1:hx4xV5wwTUfyv8LarhJAwNecnXpoTsj9v3f3q/ZkiJU=
|
||||
github.com/minio/minio-go/v7 v7.0.89/go.mod h1:2rFnGAp02p7Dddo1Fq4S2wYOfpF0MUTSeLTRC90I204=
|
||||
github.com/minio/minio-go/v7 v7.0.88 h1:v8MoIJjwYxOkehp+eiLIuvXk87P2raUtoU5klrAAshs=
|
||||
github.com/minio/minio-go/v7 v7.0.88/go.mod h1:33+O8h0tO7pCeCWwBVa07RhVVfB/3vS4kEX7rwYKmIg=
|
||||
github.com/mitchellh/cli v1.0.0/go.mod h1:hNIlj7HEI86fIcpObd7a0FcrxTWetlwJDGcceTlRvqc=
|
||||
github.com/mitchellh/copystructure v1.2.0 h1:vpKXTN4ewci03Vljg/q9QvCGUDttBOGBIa15WveJJGw=
|
||||
github.com/mitchellh/copystructure v1.2.0/go.mod h1:qLl+cE2AmVv+CoeAwDPye/v+N2HKCj9FbZEVFJRxO9s=
|
||||
@@ -829,8 +829,8 @@ github.com/nats-io/jwt/v2 v2.7.3 h1:6bNPK+FXgBeAqdj4cYQ0F8ViHRbi7woQLq4W29nUAzE=
|
||||
github.com/nats-io/jwt/v2 v2.7.3/go.mod h1:GvkcbHhKquj3pkioy5put1wvPxs78UlZ7D/pY+BgZk4=
|
||||
github.com/nats-io/nats-server/v2 v2.11.0 h1:fdwAT1d6DZW/4LUz5rkvQUe5leGEwjjOQYntzVRKvjE=
|
||||
github.com/nats-io/nats-server/v2 v2.11.0/go.mod h1:leXySghbdtXSUmWem8K9McnJ6xbJOb0t9+NQ5HTRZjI=
|
||||
github.com/nats-io/nats.go v1.41.0 h1:PzxEva7fflkd+n87OtQTXqCTyLfIIMFJBpyccHLE2Ko=
|
||||
github.com/nats-io/nats.go v1.41.0/go.mod h1:wV73x0FSI/orHPSYoyMeJB+KajMDoWyXmFaRrrYaaTo=
|
||||
github.com/nats-io/nats.go v1.39.1 h1:oTkfKBmz7W047vRxV762M67ZdXeOtUgvbBaNoQ+3PPk=
|
||||
github.com/nats-io/nats.go v1.39.1/go.mod h1:MgRb8oOdigA6cYpEPhXJuRVH6UE/V4jblJ2jQ27IXYM=
|
||||
github.com/nats-io/nkeys v0.4.10 h1:glmRrpCmYLHByYcePvnTBEAwawwapjCPMjy2huw20wc=
|
||||
github.com/nats-io/nkeys v0.4.10/go.mod h1:OjRrnIKnWBFl+s4YK5ChQfvHP2fxqZexrKJoVVyWB3U=
|
||||
github.com/nats-io/nuid v1.0.1 h1:5iA8DT8V7q8WK2EScv2padNa/rTESc1KdnPw4TC2paw=
|
||||
@@ -861,12 +861,12 @@ github.com/onsi/ginkgo/v2 v2.23.3/go.mod h1:zXTP6xIp3U8aVuXN8ENK9IXRaTjFnpVB9mGm
|
||||
github.com/onsi/gomega v1.4.3/go.mod h1:ex+gbHU/CVuBBDIJjb2X0qEXbFg53c61hWP/1CpauHY=
|
||||
github.com/onsi/gomega v1.7.1/go.mod h1:XdKZgCCFLUoM/7CFJVPcG8C1xQ1AJ0vpAezJrB7JYyY=
|
||||
github.com/onsi/gomega v1.10.1/go.mod h1:iN09h71vgCQne3DLsj+A5owkum+a2tYe+TOCB1ybHNo=
|
||||
github.com/onsi/gomega v1.37.0 h1:CdEG8g0S133B4OswTDC/5XPSzE1OeP29QOioj2PID2Y=
|
||||
github.com/onsi/gomega v1.37.0/go.mod h1:8D9+Txp43QWKhM24yyOBEdpkzN8FvJyAwecBgsU4KU0=
|
||||
github.com/open-policy-agent/opa v1.3.0 h1:zVvQvQg+9+FuSRBt4LgKNzJwsWl/c85kD5jPozJTydY=
|
||||
github.com/open-policy-agent/opa v1.3.0/go.mod h1:t9iPNhaplD2qpiBqeudzJtEX3fKHK8zdA29oFvofAHo=
|
||||
github.com/opencloud-eu/reva/v2 v2.31.0 h1:UVgeb0hSPoaDdqcKSJ7XZAhXCtHaVK9qm/JtFtJM/7U=
|
||||
github.com/opencloud-eu/reva/v2 v2.31.0/go.mod h1:8MT1a/WJASZZhlSMC0oeE3ECQdjqFw3BUiiAIZ/JR8I=
|
||||
github.com/onsi/gomega v1.36.3 h1:hID7cr8t3Wp26+cYnfcjR6HpJ00fdogN6dqZ1t6IylU=
|
||||
github.com/onsi/gomega v1.36.3/go.mod h1:8D9+Txp43QWKhM24yyOBEdpkzN8FvJyAwecBgsU4KU0=
|
||||
github.com/open-policy-agent/opa v1.2.0 h1:88NDVCM0of1eO6Z4AFeL3utTEtMuwloFmWWU7dRV1z0=
|
||||
github.com/open-policy-agent/opa v1.2.0/go.mod h1:30euUmOvuBoebRCcJ7DMF42bRBOPznvt0ACUMYDUGVY=
|
||||
github.com/opencloud-eu/reva/v2 v2.28.1-0.20250325103543-f3ec73475a58 h1:sWVVkEAz3EQOigCRQqbpgd+YzArj6HWbVUyDqtj4Frw=
|
||||
github.com/opencloud-eu/reva/v2 v2.28.1-0.20250325103543-f3ec73475a58/go.mod h1:BBTT/JIHofRQu1VdFStlXRlrwAMD3wCnVkNAx3jsfO8=
|
||||
github.com/opentracing/opentracing-go v1.1.0/go.mod h1:UkNAQd3GIcIGf0SeVgPpRdFStlNbqXla1AfSYxPUl2o=
|
||||
github.com/opentracing/opentracing-go v1.2.0 h1:uEJPy/1a5RIPAJ0Ov+OIO8OxWu77jEv+1B0VhjKrZUs=
|
||||
github.com/opentracing/opentracing-go v1.2.0/go.mod h1:GxEUsuufX4nBwe+T+Wl9TAgYrxe9dPLANfrWvHYVTgc=
|
||||
@@ -982,10 +982,11 @@ github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0t
|
||||
github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc=
|
||||
github.com/rs/cors v1.11.1 h1:eU3gRzXLRK57F5rKMGMZURNdIG4EoAmX8k94r9wXWHA=
|
||||
github.com/rs/cors v1.11.1/go.mod h1:XyqrcTp5zjWr1wsJ8PIRZssZ8b/WMcMf71DJnit4EMU=
|
||||
github.com/rs/xid v1.5.0/go.mod h1:trrq9SKmegXys3aeAKXMUTdJsYXVwGY3RLcfgqegfbg=
|
||||
github.com/rs/xid v1.6.0 h1:fV591PaemRlL6JfRxGDEPl69wICngIQ3shQtzfy2gxU=
|
||||
github.com/rs/xid v1.6.0/go.mod h1:7XoLgs4eV+QndskICGsho+ADou8ySMSjJKDIan90Nz0=
|
||||
github.com/rs/zerolog v1.34.0 h1:k43nTLIwcTVQAncfCw4KZ2VY6ukYoZaBPNOE8txlOeY=
|
||||
github.com/rs/zerolog v1.34.0/go.mod h1:bJsvje4Z08ROH4Nhs5iH600c3IkWhwp44iRc54W6wYQ=
|
||||
github.com/rs/zerolog v1.33.0 h1:1cU2KZkvPxNyfgEmhHAz/1A9Bz+llsdYzklWFzgp0r8=
|
||||
github.com/rs/zerolog v1.33.0/go.mod h1:/7mN4D5sKwJLZQ2b/znpjC3/GQWY/xaDXUM0kKWRHss=
|
||||
github.com/russellhaering/goxmldsig v1.4.0 h1:8UcDh/xGyQiyrW+Fq5t8f+l2DLB1+zlhYzkPUJ7Qhys=
|
||||
github.com/russellhaering/goxmldsig v1.4.0/go.mod h1:gM4MDENBQf7M+V824SGfyIUVFWydB7n0KkEubVJl+Tw=
|
||||
github.com/russross/blackfriday/v2 v2.0.1/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQDYRxCVz55jmeOWTM=
|
||||
@@ -1098,13 +1099,13 @@ github.com/toorop/go-dkim v0.0.0-20201103131630-e1cd1a0a5208/go.mod h1:BzWtXXrXz
|
||||
github.com/transip/gotransip/v6 v6.2.0/go.mod h1:pQZ36hWWRahCUXkFWlx9Hs711gLd8J4qdgLdRzmtY+g=
|
||||
github.com/trustelem/zxcvbn v1.0.1 h1:mp4JFtzdDYGj9WYSD3KQSkwwUumWNFzXaAjckaTYpsc=
|
||||
github.com/trustelem/zxcvbn v1.0.1/go.mod h1:zonUyKeh7sw6psPf/e3DtRqkRyZvAbOfjNz/aO7YQ5s=
|
||||
github.com/tus/tusd/v2 v2.8.0 h1:X2jGxQ05jAW4inDd2ogmOKqwnb4c/D0lw2yhgHayWyU=
|
||||
github.com/tus/tusd/v2 v2.8.0/go.mod h1:3/zEOVQQIwmJhvNam8phV4x/UQt68ZmZiTzeuJUNhVo=
|
||||
github.com/tus/tusd/v2 v2.7.1 h1:TGJjhv9RYXDmsTz8ug/qSd9vQpmD0Ik0G0IPo80Qmc0=
|
||||
github.com/tus/tusd/v2 v2.7.1/go.mod h1:PLdIMQ/ge+5ADgGKcL3FgTaPs+7wB0JIiI5HQXAiJE8=
|
||||
github.com/uber-go/atomic v1.3.2/go.mod h1:/Ct5t2lcmbJ4OSe/waGBoaVvVqtO0bmtfVNex1PFV8g=
|
||||
github.com/urfave/cli v1.22.4/go.mod h1:Gos4lmkARVdJ6EkW0WaNv/tZAAMe9V7XWyB60NtXRu0=
|
||||
github.com/urfave/cli/v2 v2.3.0/go.mod h1:LJmUH05zAU44vOAcrfzZQKsZbVcdbOG8rtL3/XcUArI=
|
||||
github.com/urfave/cli/v2 v2.27.6 h1:VdRdS98FNhKZ8/Az8B7MTyGQmpIr36O1EHybx/LaZ4g=
|
||||
github.com/urfave/cli/v2 v2.27.6/go.mod h1:3Sevf16NykTbInEnD0yKkjDAeZDS0A6bzhBH5hrMvTQ=
|
||||
github.com/urfave/cli/v2 v2.27.5 h1:WoHEJLdsXr6dDWoJgMq/CboDmyY/8HMMH1fTECbih+w=
|
||||
github.com/urfave/cli/v2 v2.27.5/go.mod h1:3Sevf16NykTbInEnD0yKkjDAeZDS0A6bzhBH5hrMvTQ=
|
||||
github.com/valyala/bytebufferpool v1.0.0/go.mod h1:6bBcMArwyJ5K/AmCkWv1jt77kVWyCJ6HpOuEn7z0Csc=
|
||||
github.com/valyala/fasttemplate v1.0.1/go.mod h1:UQGH1tvbgY+Nz5t2n7tXsz52dQxojPUpymEIMZ47gx8=
|
||||
github.com/valyala/fasttemplate v1.1.0/go.mod h1:UQGH1tvbgY+Nz5t2n7tXsz52dQxojPUpymEIMZ47gx8=
|
||||
@@ -1177,8 +1178,6 @@ go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.35.0 h1:1fTNlAIJZGWLP5FVu0f
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.35.0/go.mod h1:zjPK58DtkqQFn+YUMbx0M2XV3QgKU0gS9LeGohREyK4=
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.35.0 h1:m639+BofXTvcY1q8CGs4ItwQarYtJPOWmVobfM1HpVI=
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.35.0/go.mod h1:LjReUci/F4BUyv+y4dwnq3h/26iNOeC3wAIqgvTIZVo=
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp v1.35.0 h1:xJ2qHD0C1BeYVTLLR9sX12+Qb95kfeD/byKj6Ky1pXg=
|
||||
go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp v1.35.0/go.mod h1:u5BF1xyjstDowA1R5QAO9JHzqK+ublenEW/dyqTjBVk=
|
||||
go.opentelemetry.io/otel/metric v1.35.0 h1:0znxYu2SNyuMSQT4Y9WDWej0VpcsxkuklLa4/siN90M=
|
||||
go.opentelemetry.io/otel/metric v1.35.0/go.mod h1:nKVFgxBZ2fReX6IlyW28MgZojkoAkJGaE8CpgeAU3oE=
|
||||
go.opentelemetry.io/otel/sdk v1.35.0 h1:iPctf8iprVySXSKJffSS79eOjl9pvxV9ZqOWT0QejKY=
|
||||
@@ -1330,8 +1329,8 @@ golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
|
||||
golang.org/x/net v0.23.0/go.mod h1:JKghWKKOSdJwpW2GEx0Ja7fmaKnMsbu+MWVZTokSYmg=
|
||||
golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
|
||||
golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
|
||||
golang.org/x/net v0.38.0 h1:vRMAPTMaeGqVhG5QyLJHqNDwecKTomGeqbnfZyKlBI8=
|
||||
golang.org/x/net v0.38.0/go.mod h1:ivrbrMbzFq5J41QOQh0siUuly180yBYtLp+CKbEaFx8=
|
||||
golang.org/x/net v0.37.0 h1:1zLorHbz+LYj7MQlSf1+2tPIIgibq2eL5xkrGk6f+2c=
|
||||
golang.org/x/net v0.37.0/go.mod h1:ivrbrMbzFq5J41QOQh0siUuly180yBYtLp+CKbEaFx8=
|
||||
golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U=
|
||||
golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
|
||||
golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
|
||||
@@ -1599,8 +1598,8 @@ google.golang.org/genproto v0.0.0-20200618031413-b414f8b61790/go.mod h1:jDfRM7Fc
|
||||
google.golang.org/genproto v0.0.0-20200729003335-053ba62fc06f/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
|
||||
google.golang.org/genproto v0.0.0-20200804131852-c06518451d9c/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
|
||||
google.golang.org/genproto v0.0.0-20200825200019-8632dd797987/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no=
|
||||
google.golang.org/genproto v0.0.0-20250303144028-a0af3efb3deb h1:ITgPrl429bc6+2ZraNSzMDk3I95nmQln2fuPstKwFDE=
|
||||
google.golang.org/genproto v0.0.0-20250303144028-a0af3efb3deb/go.mod h1:sAo5UzpjUwgFBCzupwhcLcxHVDK7vG5IqI30YnwX2eE=
|
||||
google.golang.org/genproto v0.0.0-20241118233622-e639e219e697 h1:ToEetK57OidYuqD4Q5w+vfEnPvPpuTwedCNVohYJfNk=
|
||||
google.golang.org/genproto v0.0.0-20241118233622-e639e219e697/go.mod h1:JJrvXBWRZaFMxBufik1a4RpFw4HhgVtBBWQeQgUj2cc=
|
||||
google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb h1:p31xT4yrYrSM/G4Sn2+TNUkVhFCbG9y8itM2S6Th950=
|
||||
google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb/go.mod h1:jbe3Bkdp+Dh2IrslsFCklNhweNTBgSYanP1UXhJDhKg=
|
||||
google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb h1:TLPQVbx1GJ8VKZxz52VAxl1EBgKXXbTiU9Fc5fZeLn4=
|
||||
@@ -1620,8 +1619,8 @@ google.golang.org/grpc v1.29.1/go.mod h1:itym6AZVZYACWQqET3MqgPpjcuV5QH3BxFS3Iji
|
||||
google.golang.org/grpc v1.30.0/go.mod h1:N36X2cJ7JwdamYAgDz+s+rVMFjt3numwzf/HckM8pak=
|
||||
google.golang.org/grpc v1.31.0/go.mod h1:N36X2cJ7JwdamYAgDz+s+rVMFjt3numwzf/HckM8pak=
|
||||
google.golang.org/grpc v1.33.2/go.mod h1:JMHMWHQWaTccqQQlmk3MJZS+GWXOdAesneDmEnv2fbc=
|
||||
google.golang.org/grpc v1.71.1 h1:ffsFWr7ygTUscGPI0KKK6TLrGz0476KUvvsbqWK0rPI=
|
||||
google.golang.org/grpc v1.71.1/go.mod h1:H0GRtasmQOh9LkFoCPDu3ZrwUtD1YGE+b2vYBYd/8Ec=
|
||||
google.golang.org/grpc v1.71.0 h1:kF77BGdPTQ4/JZWMlb9VpJ5pa25aqvVqogsxNHHdeBg=
|
||||
google.golang.org/grpc v1.71.0/go.mod h1:H0GRtasmQOh9LkFoCPDu3ZrwUtD1YGE+b2vYBYd/8Ec=
|
||||
google.golang.org/grpc/examples v0.0.0-20211102180624-670c133e568e h1:m7aQHHqd0q89mRwhwS9Bx2rjyl/hsFAeta+uGrHsQaU=
|
||||
google.golang.org/grpc/examples v0.0.0-20211102180624-670c133e568e/go.mod h1:gID3PKrg7pWKntu9Ss6zTLJ0ttC0X9IHgREOCZwbCVU=
|
||||
google.golang.org/protobuf v0.0.0-20200109180630-ec00e32a8dfd/go.mod h1:DFci5gLYBciE7Vtevhsrf46CRTquxDuWsQurQQe4oz8=
|
||||
@@ -1638,8 +1637,8 @@ google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp0
|
||||
google.golang.org/protobuf v1.26.0/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc=
|
||||
google.golang.org/protobuf v1.28.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
|
||||
google.golang.org/protobuf v1.28.1/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
|
||||
google.golang.org/protobuf v1.36.6 h1:z1NpPI8ku2WgiWnf+t9wTPsn6eP1L7ksHUlkfLvd9xY=
|
||||
google.golang.org/protobuf v1.36.6/go.mod h1:jduwjTPXsFjZGTmRluh+L6NjiWu7pchiJ2/5YcXBHnY=
|
||||
google.golang.org/protobuf v1.36.5 h1:tPhr+woSbjfYvY6/GPufUoYizxw1cF/yFoxJ2fmpwlM=
|
||||
google.golang.org/protobuf v1.36.5/go.mod h1:9fA7Ob0pmnwhb644+1+CVWFRbNajQ6iRojtC/QF5bRE=
|
||||
gopkg.in/alecthomas/kingpin.v2 v2.2.6/go.mod h1:FMv+mEhP44yOT+4EoQTLFTRgOQ1FBLkstjWtayDeSgw=
|
||||
gopkg.in/cenkalti/backoff.v1 v1.1.0 h1:Arh75ttbsvlpVA7WtVpH4u9h6Zl46xuptxqLxPiSo4Y=
|
||||
gopkg.in/cenkalti/backoff.v1 v1.1.0/go.mod h1:J6Vskwqd+OMVJl8C33mmtxTBs2gyzfv7UDAkHu8BrjI=
|
||||
|
||||
@@ -22,8 +22,6 @@ RUN addgroup -g 1000 -S opencloud-group && \
|
||||
adduser -S --ingroup opencloud-group --uid 1000 opencloud-user --home /var/lib/opencloud
|
||||
|
||||
RUN mkdir -p /var/lib/opencloud && \
|
||||
# Pre-create the web directory to avoid permission issues
|
||||
mkdir -p /var/lib/opencloud/web/assets/apps && \
|
||||
chown -R opencloud-user:opencloud-group /var/lib/opencloud && \
|
||||
chmod -R 751 /var/lib/opencloud && \
|
||||
mkdir -p /etc/opencloud && \
|
||||
|
||||
@@ -22,8 +22,6 @@ RUN addgroup -g 1000 -S opencloud-group && \
|
||||
adduser -S --ingroup opencloud-group --uid 1000 opencloud-user --home /var/lib/opencloud
|
||||
|
||||
RUN mkdir -p /var/lib/opencloud && \
|
||||
# Pre-create the web directory to avoid permission issues
|
||||
mkdir -p /var/lib/opencloud/web/assets/apps && \
|
||||
chown -R opencloud-user:opencloud-group /var/lib/opencloud && \
|
||||
chmod -R 751 /var/lib/opencloud && \
|
||||
mkdir -p /etc/opencloud && \
|
||||
|
||||
@@ -22,8 +22,6 @@ RUN addgroup -g 1000 -S opencloud-group && \
|
||||
adduser -S --ingroup opencloud-group --uid 1000 opencloud-user --home /var/lib/opencloud
|
||||
|
||||
RUN mkdir -p /var/lib/opencloud && \
|
||||
# Pre-create the web directory to avoid permission issues
|
||||
mkdir -p /var/lib/opencloud/web/assets/apps && \
|
||||
chown -R opencloud-user:opencloud-group /var/lib/opencloud && \
|
||||
chmod -R 751 /var/lib/opencloud && \
|
||||
mkdir -p /etc/opencloud && \
|
||||
|
||||
@@ -22,8 +22,6 @@ RUN addgroup -g 1000 -S opencloud-group && \
|
||||
adduser -S --ingroup opencloud-group --uid 1000 opencloud-user --home /var/lib/opencloud
|
||||
|
||||
RUN mkdir -p /var/lib/opencloud && \
|
||||
# Pre-create the web directory to avoid permission issues
|
||||
mkdir -p /var/lib/opencloud/web/assets/apps && \
|
||||
chown -R opencloud-user:opencloud-group /var/lib/opencloud && \
|
||||
chmod -R 751 /var/lib/opencloud && \
|
||||
mkdir -p /etc/opencloud && \
|
||||
|
||||
@@ -37,8 +37,6 @@ RUN addgroup -g 1000 -S opencloud-group && \
|
||||
adduser -S --ingroup opencloud-group --uid 1000 opencloud-user --home /var/lib/opencloud
|
||||
|
||||
RUN mkdir -p /var/lib/opencloud && \
|
||||
# Pre-create the web directory to avoid permission issues
|
||||
mkdir -p /var/lib/opencloud/web/assets/apps && \
|
||||
chown -R opencloud-user:opencloud-group /var/lib/opencloud && \
|
||||
chmod -R 751 /var/lib/opencloud && \
|
||||
mkdir -p /etc/opencloud && \
|
||||
|
||||
@@ -2716,7 +2716,7 @@ var (
|
||||
|
||||
// errMaxExprCnt is used to signal that the maximum number of
|
||||
// expressions have been parsed.
|
||||
errMaxExprCnt = errors.New("max number of expressions parsed")
|
||||
errMaxExprCnt = errors.New("max number of expresssions parsed")
|
||||
)
|
||||
|
||||
// Option is a function that can set an option on the parser. It returns
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -16,7 +16,7 @@ var (
|
||||
// LatestTag is the latest released version plus the dev meta version.
|
||||
// Will be overwritten by the release pipeline
|
||||
// Needs a manual change for every tagged release
|
||||
LatestTag = "2.0.0+dev"
|
||||
LatestTag = "1.1.0+dev"
|
||||
|
||||
// Date indicates the build date.
|
||||
// This has been removed, it looks like you can only replace static strings with recent go versions
|
||||
@@ -46,17 +46,18 @@ func GetString() string {
|
||||
// Parsed returns a semver Version
|
||||
func Parsed() (version *semver.Version) {
|
||||
versionToParse := LatestTag
|
||||
// use the placeholder version if the tag is empty or when we are creating a daily build
|
||||
if Tag != "" && Tag != "daily" {
|
||||
if Tag != "" {
|
||||
versionToParse = Tag
|
||||
}
|
||||
version, err := semver.NewVersion(versionToParse)
|
||||
// We have no semver version but a commitid
|
||||
if err != nil {
|
||||
// this should never happen
|
||||
return &semver.Version{}
|
||||
if err != nil {
|
||||
return &semver.Version{}
|
||||
}
|
||||
}
|
||||
if String != "" {
|
||||
// We have no tagged version but a commitid
|
||||
nVersion, err := version.SetMetadata(String)
|
||||
if err != nil {
|
||||
return &semver.Version{}
|
||||
|
||||
@@ -1,49 +0,0 @@
|
||||
export default {
|
||||
changeTypes: [
|
||||
{
|
||||
title: '💥 Breaking changes',
|
||||
labels: ['breaking', 'Type:Breaking-Change'],
|
||||
bump: 'major',
|
||||
weight: 3
|
||||
},
|
||||
{
|
||||
title: '🔒 Security',
|
||||
labels: ['security', 'Type:Security'],
|
||||
bump: 'patch',
|
||||
weight: 2
|
||||
},
|
||||
{
|
||||
title: '✨ Features',
|
||||
labels: ['feature', 'Type:Feature'],
|
||||
bump: 'minor',
|
||||
weight: 1
|
||||
},
|
||||
{
|
||||
title: '📈 Enhancement',
|
||||
labels: ['enhancement', 'refactor', 'Type:Enhancement'],
|
||||
bump: 'minor'
|
||||
},
|
||||
{
|
||||
title: '🐛 Bug Fixes',
|
||||
labels: ['bug', 'Type:Bug'],
|
||||
bump: 'patch'
|
||||
},
|
||||
{
|
||||
title: '📚 Documentation',
|
||||
labels: ['docs', 'documentation', 'Type:Documentation'],
|
||||
bump: 'patch'
|
||||
},
|
||||
{
|
||||
title: '✅ Tests',
|
||||
labels: ['test', 'tests', 'Type:Test'],
|
||||
bump: 'patch'
|
||||
},
|
||||
{
|
||||
title: '📦️ Dependencies',
|
||||
labels: ['dependency', 'dependencies', 'Type:Dependencies'],
|
||||
bump: 'patch',
|
||||
weight: -1
|
||||
}
|
||||
],
|
||||
useVersionPrefixV: true,
|
||||
}
|
||||
@@ -4,10 +4,7 @@ The `antivirus` service is responsible for scanning files for viruses.
|
||||
|
||||
## Memory Considerations
|
||||
|
||||
The antivirus service can consume considerable amounts of memory.
|
||||
This is relevant to provide or define sufficient memory for the deployment selected.
|
||||
To avoid out of memory (OOM) situations, the following equation gives a rough overview based on experiences made.
|
||||
The memory calculation comes without any guarantee, is intended as overview only and subject of change.
|
||||
The antivirus service can consume considerably amounts of memory. This is relevant to provide or define sufficient memory for the deployment selected. To avoid out of memory (OOM) situations, the following equation gives a rough overview based on experiences made. The memory calculation comes without any guarantee, is intended as overview only and subject of change.
|
||||
|
||||
`memory limit` = `max file size` x `workers` x `factor 8 - 14`
|
||||
|
||||
@@ -22,31 +19,17 @@ With:
|
||||
|
||||
### Antivirus Scanner Type
|
||||
|
||||
The antivirus service currently supports [ICAP](https://tools.ietf.org/html/rfc3507) and [ClamAV](http://www.clamav.net/index.html) as antivirus scanners.
|
||||
The `ANTIVIRUS_SCANNER_TYPE` environment variable is used to select the scanner.
|
||||
The detailed configuration for each scanner heavily depends on the scanner type selected.
|
||||
See the environment variables for more details.
|
||||
The antivirus service currently supports [ICAP](https://tools.ietf.org/html/rfc3507) and [ClamAV](http://www.clamav.net/index.html) as antivirus scanners. The `ANTIVIRUS_SCANNER_TYPE` environment variable is used to select the scanner. The detailed configuration for each scanner heavily depends on the scanner type selected. See the environment variables for more details.
|
||||
|
||||
- For `icap`, only scanners using the `X-Infection-Found` header are currently supported.
|
||||
- For `clamav` only local sockets can currently be configured.
|
||||
|
||||
### Maximum Scan Size
|
||||
|
||||
Several factors can make it necessary to limit the maximum filesize the antivirus service uses for scanning.
|
||||
Use the `ANTIVIRUS_MAX_SCAN_SIZE` environment variable to scan only a given number of bytes,
|
||||
or to skip the whole resource.
|
||||
|
||||
Even if it's recommended to scan the whole file, several factors like scanner type and version,
|
||||
bandwidth, performance issues, etc. might make a limit necessary.
|
||||
|
||||
In such cases, the antivirus the max scan size mode can be handy, the following modes are available:
|
||||
|
||||
- `partial`: The file is scanned up to the given size. The rest of the file is not scanned. This is the default mode `ANTIVIRUS_MAX_SCAN_SIZE=partial`
|
||||
- `skip`: The file is skipped and not scanned. `ANTIVIRUS_MAX_SCAN_SIZE=skip`
|
||||
Several factors can make it necessary to limit the maximum filesize the antivirus service will use for scanning. Use the `ANTIVIRUS_MAX_SCAN_SIZE` environment variable to scan only a given amount of bytes. Obviously, it is recommended to scan the whole file, but several factors like scanner type and version, bandwidth, performance issues, etc. might make a limit necessary.
|
||||
|
||||
**IMPORTANT**
|
||||
> Streaming of files to the virus scan service still [needs to be implemented](https://github.com/owncloud/ocis/issues/6803).
|
||||
> To prevent OOM errors `ANTIVIRUS_MAX_SCAN_SIZE` needs to be set lower than available ram and or the maximum file size that can be scanned by the virus scanner.
|
||||
> Streaming of files to the virus scan service still [needs to be implemented](https://github.com/owncloud/ocis/issues/6803). To prevent OOM errors `ANTIVIRUS_MAX_SCAN_SIZE` needs to be set lower than available ram.
|
||||
|
||||
### Antivirus Workers
|
||||
|
||||
@@ -58,7 +41,7 @@ The antivirus service allows three different ways of handling infected files. Th
|
||||
|
||||
- `delete`: (default): Infected files will be deleted immediately, further postprocessing is cancelled.
|
||||
- `abort`: (advanced option): Infected files will be kept, further postprocessing is cancelled. Files can be manually retrieved and inspected by an admin. To identify the file for further investigation, the antivirus service logs the abort/infected state including the file ID. The file is located in the `storage/users/uploads` folder of the OpenCloud data directory and persists until it is manually deleted by the admin via the [Manage Unfinished Uploads](https://github.com/opencloud-eu/opencloud/tree/main/services/storage-users#manage-unfinished-uploads) command.
|
||||
- `continue`: (not recommended): Infected files will be marked via metadata as infected, but postprocessing continues normally. Note: Infected Files are moved to their final destination and therefore not prevented from download, which includes the risk of spreading viruses.
|
||||
- `continue`: (obviously not recommended): Infected files will be marked via metadata as infected but postprocessing continues normally. Note: Infected Files are moved to their final destination and therefore not prevented from download which includes the risk of spreading viruses.
|
||||
|
||||
In all cases, a log entry is added declaring the infection and handling method and a notification via the `userlog` service sent.
|
||||
|
||||
|
||||
@@ -45,7 +45,7 @@ func Server(cfg *config.Config) *cli.Command {
|
||||
{
|
||||
svc, err := service.NewAntivirus(cfg, logger, traceProvider)
|
||||
if err != nil {
|
||||
return cli.Exit(err.Error(), 1)
|
||||
return err
|
||||
}
|
||||
|
||||
gr.Add(svc.Run, func(_ error) {
|
||||
|
||||
@@ -5,26 +5,6 @@ import (
|
||||
"time"
|
||||
)
|
||||
|
||||
// ScannerType gives info which scanner is used
|
||||
type ScannerType string
|
||||
|
||||
const (
|
||||
// ScannerTypeClamAV defines that clamav is used
|
||||
ScannerTypeClamAV ScannerType = "clamav"
|
||||
// ScannerTypeICap defines that icap is used
|
||||
ScannerTypeICap ScannerType = "icap"
|
||||
)
|
||||
|
||||
// MaxScanSizeMode defines the mode of handling files that exceed the maximum scan size
|
||||
type MaxScanSizeMode string
|
||||
|
||||
const (
|
||||
// MaxScanSizeModeSkip defines that files that are bigger than the max scan size will be skipped
|
||||
MaxScanSizeModeSkip MaxScanSizeMode = "skip"
|
||||
// MaxScanSizeModePartial defines that only the file up to the max size will be used
|
||||
MaxScanSizeModePartial MaxScanSizeMode = "partial"
|
||||
)
|
||||
|
||||
// Config combines all available configuration parts.
|
||||
type Config struct {
|
||||
File string
|
||||
@@ -40,9 +20,8 @@ type Config struct {
|
||||
Events Events
|
||||
Workers int `yaml:"workers" env:"ANTIVIRUS_WORKERS" desc:"The number of concurrent go routines that fetch events from the event queue." introductionVersion:"1.0.0"`
|
||||
|
||||
Scanner Scanner
|
||||
MaxScanSize string `yaml:"max-scan-size" env:"ANTIVIRUS_MAX_SCAN_SIZE" desc:"The maximum scan size the virus scanner can handle.0 means unlimited. Usable common abbreviations: [KB, KiB, MB, MiB, GB, GiB, TB, TiB, PB, PiB, EB, EiB], example: 2GB." introductionVersion:"1.0.0"`
|
||||
MaxScanSizeMode MaxScanSizeMode `yaml:"max-scan-size-mode" env:"ANTIVIRUS_MAX_SCAN_SIZE_MODE" desc:"Defines the mode of handling files that exceed the maximum scan size. Supported options are: 'skip', which skips files that are bigger than the max scan size, and 'truncate' (default), which only uses the file up to the max size." introductionVersion:"2.1.0"`
|
||||
Scanner Scanner
|
||||
MaxScanSize string `yaml:"max-scan-size" env:"ANTIVIRUS_MAX_SCAN_SIZE" desc:"The maximum scan size the virus scanner can handle. Only this many bytes of a file will be scanned. 0 means unlimited and is the default. Usable common abbreviations: [KB, KiB, MB, MiB, GB, GiB, TB, TiB, PB, PiB, EB, EiB], example: 2GB." introductionVersion:"1.0.0"`
|
||||
|
||||
Context context.Context `json:"-" yaml:"-"`
|
||||
|
||||
@@ -83,7 +62,7 @@ type Events struct {
|
||||
|
||||
// Scanner provides configuration options for the virus scanner
|
||||
type Scanner struct {
|
||||
Type ScannerType `yaml:"type" env:"ANTIVIRUS_SCANNER_TYPE" desc:"The antivirus scanner to use. Supported values are 'clamav' and 'icap'." introductionVersion:"1.0.0"`
|
||||
Type string `yaml:"type" env:"ANTIVIRUS_SCANNER_TYPE" desc:"The antivirus scanner to use. Supported values are 'clamav' and 'icap'." introductionVersion:"1.0.0"`
|
||||
|
||||
ClamAV ClamAV // only if Type == clamav
|
||||
ICAP ICAP // only if Type == icap
|
||||
@@ -91,8 +70,7 @@ type Scanner struct {
|
||||
|
||||
// ClamAV provides configuration option for clamav
|
||||
type ClamAV struct {
|
||||
Socket string `yaml:"socket" env:"ANTIVIRUS_CLAMAV_SOCKET" desc:"The socket clamav is running on. Note the default value is an example which needs adaption according your OS." introductionVersion:"1.0.0"`
|
||||
Timeout time.Duration `yaml:"scan_timeout" env:"ANTIVIRUS_CLAMAV_SCAN_TIMEOUT" desc:"Scan timeout for the ClamAV client. Defaults to '5m' (5 minutes). See the Environment Variable Types description for more details." introductionVersion:"2.1.0"`
|
||||
Socket string `yaml:"socket" env:"ANTIVIRUS_CLAMAV_SOCKET" desc:"The socket clamav is running on. Note the default value is an example which needs adaption according your OS." introductionVersion:"1.0.0"`
|
||||
}
|
||||
|
||||
// ICAP provides configuration options for icap
|
||||
|
||||
@@ -30,15 +30,10 @@ func DefaultConfig() *config.Config {
|
||||
},
|
||||
Workers: 10,
|
||||
InfectedFileHandling: "delete",
|
||||
// defaults from clamav sample conf: MaxScanSize=400M, MaxFileSize=100M, StreamMaxLength=100M
|
||||
// https://github.com/Cisco-Talos/clamav/blob/main/etc/clamd.conf.sample
|
||||
MaxScanSize: "100MB",
|
||||
MaxScanSizeMode: config.MaxScanSizeModePartial,
|
||||
Scanner: config.Scanner{
|
||||
Type: config.ScannerTypeClamAV,
|
||||
Type: "clamav",
|
||||
ClamAV: config.ClamAV{
|
||||
Socket: "/run/clamav/clamd.ctl",
|
||||
Timeout: 5 * time.Minute,
|
||||
Socket: "/run/clamav/clamd.ctl",
|
||||
},
|
||||
ICAP: config.ICAP{
|
||||
URL: "icap://127.0.0.1:1344",
|
||||
@@ -62,9 +57,4 @@ func EnsureDefaults(cfg *config.Config) {
|
||||
|
||||
// Sanitize sanitizes the configuration
|
||||
func Sanitize(cfg *config.Config) {
|
||||
defaultConfig := DefaultConfig()
|
||||
|
||||
if cfg.MaxScanSize == "" {
|
||||
cfg.MaxScanSize = defaultConfig.MaxScanSize
|
||||
}
|
||||
}
|
||||
|
||||
@@ -1,51 +1,34 @@
|
||||
package scanners
|
||||
|
||||
import (
|
||||
"fmt"
|
||||
"time"
|
||||
|
||||
"github.com/dutchcoders/go-clamd"
|
||||
)
|
||||
|
||||
// NewClamAV returns a Scanner talking to clamAV via socket
|
||||
func NewClamAV(socket string, timeout time.Duration) (*ClamAV, error) {
|
||||
c := clamd.NewClamd(socket)
|
||||
|
||||
if err := c.Ping(); err != nil {
|
||||
return nil, fmt.Errorf("%w: %w", ErrScannerNotReachable, err)
|
||||
}
|
||||
|
||||
func NewClamAV(socket string) *ClamAV {
|
||||
return &ClamAV{
|
||||
clamd: clamd.NewClamd(socket),
|
||||
timeout: timeout,
|
||||
}, nil
|
||||
clamd: clamd.NewClamd(socket),
|
||||
}
|
||||
}
|
||||
|
||||
// ClamAV is a Scanner based on clamav
|
||||
type ClamAV struct {
|
||||
clamd *clamd.Clamd
|
||||
timeout time.Duration
|
||||
clamd *clamd.Clamd
|
||||
}
|
||||
|
||||
// Scan to fulfill Scanner interface
|
||||
func (s ClamAV) Scan(in Input) (Result, error) {
|
||||
abort := make(chan bool, 1)
|
||||
defer close(abort)
|
||||
|
||||
ch, err := s.clamd.ScanStream(in.Body, abort)
|
||||
ch, err := s.clamd.ScanStream(in.Body, make(chan bool))
|
||||
if err != nil {
|
||||
return Result{}, err
|
||||
}
|
||||
|
||||
select {
|
||||
case <-time.After(s.timeout):
|
||||
abort <- true
|
||||
return Result{}, fmt.Errorf("%w: %s", ErrScanTimeout, in.Url)
|
||||
case s := <-ch:
|
||||
return Result{
|
||||
Infected: s.Status == clamd.RES_FOUND,
|
||||
Description: s.Description,
|
||||
ScanTime: time.Now(),
|
||||
}, nil
|
||||
}
|
||||
r := <-ch
|
||||
return Result{
|
||||
Infected: r.Status == clamd.RES_FOUND,
|
||||
Description: r.Description,
|
||||
ScanTime: time.Now(),
|
||||
}, nil
|
||||
}
|
||||
|
||||
@@ -1,120 +0,0 @@
|
||||
package scanners_test
|
||||
|
||||
import (
|
||||
"context"
|
||||
"net"
|
||||
"os"
|
||||
"path/filepath"
|
||||
"strings"
|
||||
"testing"
|
||||
"time"
|
||||
|
||||
"github.com/stretchr/testify/assert"
|
||||
"github.com/stretchr/testify/require"
|
||||
|
||||
"github.com/opencloud-eu/opencloud/services/antivirus/pkg/scanners"
|
||||
)
|
||||
|
||||
func newUnixListener(t testing.TB, lc net.ListenConfig, v ...string) net.Listener {
|
||||
d, err := os.MkdirTemp("", "")
|
||||
assert.NoError(t, err)
|
||||
t.Cleanup(func() {
|
||||
require.NoError(t, os.RemoveAll(d))
|
||||
})
|
||||
|
||||
nl, err := lc.Listen(context.Background(), "unix", filepath.Join(d, "sock"))
|
||||
require.NoError(t, err)
|
||||
|
||||
go func() {
|
||||
i := 0
|
||||
for {
|
||||
if len(v) == i {
|
||||
break
|
||||
}
|
||||
|
||||
conn, err := nl.Accept()
|
||||
require.NoError(t, err)
|
||||
|
||||
time.Sleep(100 * time.Millisecond)
|
||||
|
||||
_, err = conn.Write([]byte(v[i]))
|
||||
require.NoError(t, err)
|
||||
require.NoError(t, conn.Close())
|
||||
i++
|
||||
}
|
||||
}()
|
||||
|
||||
return nl
|
||||
}
|
||||
|
||||
func TestNewClamAV(t *testing.T) {
|
||||
t.Run("returns a scanner", func(t *testing.T) {
|
||||
ul := newUnixListener(t, net.ListenConfig{}, "PONG\n")
|
||||
defer func() {
|
||||
assert.NoError(t, ul.Close())
|
||||
}()
|
||||
|
||||
done := make(chan bool, 1)
|
||||
|
||||
go func() {
|
||||
_, err := scanners.NewClamAV(ul.Addr().String(), 10*time.Second)
|
||||
assert.NoError(t, err)
|
||||
done <- true
|
||||
}()
|
||||
|
||||
assert.True(t, <-done)
|
||||
})
|
||||
|
||||
t.Run("fails if scanner is not pingable", func(t *testing.T) {
|
||||
_, err := scanners.NewClamAV("", 0)
|
||||
assert.ErrorIs(t, err, scanners.ErrScannerNotReachable)
|
||||
})
|
||||
}
|
||||
|
||||
func TestNewClamAV_Scan(t *testing.T) {
|
||||
t.Run("returns a result", func(t *testing.T) {
|
||||
ul := newUnixListener(t, net.ListenConfig{}, "PONG\n", "stream: Win.Test.EICAR_HDB-1 FOUND\n")
|
||||
defer func() {
|
||||
assert.NoError(t, ul.Close())
|
||||
}()
|
||||
|
||||
done := make(chan bool, 1)
|
||||
|
||||
go func() {
|
||||
scanner, err := scanners.NewClamAV(ul.Addr().String(), 10*time.Second)
|
||||
assert.NoError(t, err)
|
||||
|
||||
result, err := scanner.Scan(scanners.Input{Body: strings.NewReader("DATA")})
|
||||
assert.NoError(t, err)
|
||||
|
||||
assert.Equal(t, result.Description, "Win.Test.EICAR_HDB-1")
|
||||
assert.True(t, result.Infected)
|
||||
done <- true
|
||||
}()
|
||||
|
||||
assert.True(t, <-done)
|
||||
})
|
||||
|
||||
t.Run("aborts after a certain time", func(t *testing.T) {
|
||||
ul := newUnixListener(t, net.ListenConfig{}, "PONG\n", "stream: Win.Test.EICAR_HDB-1 FOUND\n")
|
||||
defer func() {
|
||||
assert.NoError(t, ul.Close())
|
||||
}()
|
||||
|
||||
done := make(chan bool, 1)
|
||||
|
||||
go func() {
|
||||
scanner, err := scanners.NewClamAV(ul.Addr().String(), 10*time.Second)
|
||||
assert.NoError(t, err)
|
||||
|
||||
result, err := scanner.Scan(scanners.Input{Body: strings.NewReader("DATA")})
|
||||
assert.NoError(t, err)
|
||||
|
||||
assert.Equal(t, result.Description, "Win.Test.EICAR_HDB-1")
|
||||
assert.True(t, result.Infected)
|
||||
done <- true
|
||||
}()
|
||||
|
||||
assert.True(t, <-done)
|
||||
})
|
||||
}
|
||||
@@ -1,31 +1,21 @@
|
||||
package scanners
|
||||
|
||||
import (
|
||||
"errors"
|
||||
"io"
|
||||
"time"
|
||||
)
|
||||
|
||||
var (
|
||||
// ErrScanTimeout is returned when a scan times out
|
||||
ErrScanTimeout = errors.New("time out waiting for clamav to respond while scanning")
|
||||
// ErrScannerNotReachable is returned when the scanner is not reachable
|
||||
ErrScannerNotReachable = errors.New("failed to reach the scanner")
|
||||
)
|
||||
// The Result is the common scan result to all scanners
|
||||
type Result struct {
|
||||
Infected bool
|
||||
ScanTime time.Time
|
||||
Description string
|
||||
}
|
||||
|
||||
type (
|
||||
// The Result is the common scan result to all scanners
|
||||
Result struct {
|
||||
Infected bool
|
||||
ScanTime time.Time
|
||||
Description string
|
||||
}
|
||||
|
||||
// The Input is the common input to all scanners
|
||||
Input struct {
|
||||
Body io.Reader
|
||||
Size int64
|
||||
Url string
|
||||
Name string
|
||||
}
|
||||
)
|
||||
// The Input is the common input to all scanners
|
||||
type Input struct {
|
||||
Body io.Reader
|
||||
Size int64
|
||||
Url string
|
||||
Name string
|
||||
}
|
||||
|
||||
@@ -9,7 +9,6 @@ import (
|
||||
"io"
|
||||
"net/http"
|
||||
"os"
|
||||
"slices"
|
||||
"sync"
|
||||
"time"
|
||||
|
||||
@@ -38,44 +37,38 @@ type Scanner interface {
|
||||
}
|
||||
|
||||
// NewAntivirus returns a service implementation for Service.
|
||||
func NewAntivirus(cfg *config.Config, logger log.Logger, tracerProvider trace.TracerProvider) (Antivirus, error) {
|
||||
func NewAntivirus(c *config.Config, l log.Logger, tp trace.TracerProvider) (Antivirus, error) {
|
||||
|
||||
var scanner Scanner
|
||||
var err error
|
||||
switch cfg.Scanner.Type {
|
||||
switch c.Scanner.Type {
|
||||
default:
|
||||
return Antivirus{}, fmt.Errorf("unknown av scanner: '%s'", cfg.Scanner.Type)
|
||||
case config.ScannerTypeClamAV:
|
||||
scanner, err = scanners.NewClamAV(cfg.Scanner.ClamAV.Socket, cfg.Scanner.ClamAV.Timeout)
|
||||
case config.ScannerTypeICap:
|
||||
scanner, err = scanners.NewICAP(cfg.Scanner.ICAP.URL, cfg.Scanner.ICAP.Service, cfg.Scanner.ICAP.Timeout)
|
||||
return Antivirus{}, fmt.Errorf("unknown av scanner: '%s'", c.Scanner.Type)
|
||||
case "clamav":
|
||||
scanner = scanners.NewClamAV(c.Scanner.ClamAV.Socket)
|
||||
case "icap":
|
||||
scanner, err = scanners.NewICAP(c.Scanner.ICAP.URL, c.Scanner.ICAP.Service, c.Scanner.ICAP.Timeout)
|
||||
}
|
||||
if err != nil {
|
||||
return Antivirus{}, err
|
||||
}
|
||||
|
||||
av := Antivirus{config: cfg, log: logger, tracerProvider: tracerProvider, scanner: scanner, client: rhttp.GetHTTPClient(rhttp.Insecure(true))}
|
||||
av := Antivirus{c: c, l: l, tp: tp, s: scanner, client: rhttp.GetHTTPClient(rhttp.Insecure(true))}
|
||||
|
||||
switch mode := cfg.MaxScanSizeMode; mode {
|
||||
case config.MaxScanSizeModeSkip, config.MaxScanSizeModePartial:
|
||||
break
|
||||
default:
|
||||
return av, fmt.Errorf("unknown max scan size mode '%s'", cfg.MaxScanSizeMode)
|
||||
}
|
||||
|
||||
switch outcome := events.PostprocessingOutcome(cfg.InfectedFileHandling); outcome {
|
||||
switch o := events.PostprocessingOutcome(c.InfectedFileHandling); o {
|
||||
case events.PPOutcomeContinue, events.PPOutcomeAbort, events.PPOutcomeDelete:
|
||||
av.outcome = outcome
|
||||
av.o = o
|
||||
default:
|
||||
return av, fmt.Errorf("unknown infected file handling '%s'", outcome)
|
||||
return av, fmt.Errorf("unknown infected file handling '%s'", o)
|
||||
}
|
||||
|
||||
if cfg.MaxScanSize != "" {
|
||||
b, err := bytesize.Parse(cfg.MaxScanSize)
|
||||
if c.MaxScanSize != "" {
|
||||
b, err := bytesize.Parse(c.MaxScanSize)
|
||||
if err != nil {
|
||||
return av, err
|
||||
}
|
||||
|
||||
av.maxScanSize = b.Bytes()
|
||||
av.m = b.Bytes()
|
||||
}
|
||||
|
||||
return av, nil
|
||||
@@ -83,23 +76,23 @@ func NewAntivirus(cfg *config.Config, logger log.Logger, tracerProvider trace.Tr
|
||||
|
||||
// Antivirus defines implements the business logic for Service.
|
||||
type Antivirus struct {
|
||||
config *config.Config
|
||||
log log.Logger
|
||||
scanner Scanner
|
||||
outcome events.PostprocessingOutcome
|
||||
maxScanSize uint64
|
||||
tracerProvider trace.TracerProvider
|
||||
c *config.Config
|
||||
l log.Logger
|
||||
s Scanner
|
||||
o events.PostprocessingOutcome
|
||||
m uint64
|
||||
tp trace.TracerProvider
|
||||
|
||||
client *http.Client
|
||||
}
|
||||
|
||||
// Run runs the service
|
||||
func (av Antivirus) Run() error {
|
||||
eventsCfg := av.config.Events
|
||||
evtsCfg := av.c.Events
|
||||
|
||||
var rootCAPool *x509.CertPool
|
||||
if av.config.Events.TLSRootCACertificate != "" {
|
||||
rootCrtFile, err := os.Open(eventsCfg.TLSRootCACertificate)
|
||||
if av.c.Events.TLSRootCACertificate != "" {
|
||||
rootCrtFile, err := os.Open(evtsCfg.TLSRootCACertificate)
|
||||
if err != nil {
|
||||
return err
|
||||
}
|
||||
@@ -111,10 +104,10 @@ func (av Antivirus) Run() error {
|
||||
|
||||
rootCAPool = x509.NewCertPool()
|
||||
rootCAPool.AppendCertsFromPEM(certBytes.Bytes())
|
||||
av.config.Events.TLSInsecure = false
|
||||
av.c.Events.TLSInsecure = false
|
||||
}
|
||||
|
||||
natsStream, err := stream.NatsFromConfig(av.config.Service.Name, false, stream.NatsConfig(av.config.Events))
|
||||
natsStream, err := stream.NatsFromConfig(av.c.Service.Name, false, stream.NatsConfig(av.c.Events))
|
||||
if err != nil {
|
||||
return err
|
||||
}
|
||||
@@ -125,7 +118,7 @@ func (av Antivirus) Run() error {
|
||||
}
|
||||
|
||||
wg := sync.WaitGroup{}
|
||||
for i := 0; i < av.config.Workers; i++ {
|
||||
for i := 0; i < av.c.Workers; i++ {
|
||||
wg.Add(1)
|
||||
go func() {
|
||||
defer wg.Done()
|
||||
@@ -134,11 +127,11 @@ func (av Antivirus) Run() error {
|
||||
if err != nil {
|
||||
switch {
|
||||
case errors.Is(err, ErrFatal):
|
||||
av.log.Fatal().Err(err).Msg("fatal error - exiting")
|
||||
av.l.Fatal().Err(err).Msg("fatal error - exiting")
|
||||
case errors.Is(err, ErrEvent):
|
||||
av.log.Error().Err(err).Msg("continuing")
|
||||
av.l.Error().Err(err).Msg("continuing")
|
||||
default:
|
||||
av.log.Fatal().Err(err).Msg("unknown error - exiting")
|
||||
av.l.Fatal().Err(err).Msg("unknown error - exiting")
|
||||
}
|
||||
}
|
||||
}
|
||||
@@ -150,20 +143,20 @@ func (av Antivirus) Run() error {
|
||||
}
|
||||
|
||||
func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
ctx, span := av.tracerProvider.Tracer("antivirus").Start(e.GetTraceContext(context.Background()), "processEvent")
|
||||
ctx := e.GetTraceContext(context.Background())
|
||||
ctx, span := av.tp.Tracer("antivirus").Start(ctx, "processEvent")
|
||||
defer span.End()
|
||||
av.log.Info().Str("traceID", span.SpanContext().TraceID().String()).Msg("TraceID")
|
||||
|
||||
av.l.Info().Str("traceID", span.SpanContext().TraceID().String()).Msg("TraceID")
|
||||
ev := e.Event.(events.StartPostprocessingStep)
|
||||
if ev.StepToStart != events.PPStepAntivirus {
|
||||
return nil
|
||||
}
|
||||
|
||||
if av.config.DebugScanOutcome != "" {
|
||||
av.log.Warn().Str("antivir, clamav", ">>>>>>> ANTIVIRUS_DEBUG_SCAN_OUTCOME IS SET NO ACTUAL VIRUS SCAN IS PERFORMED!").Send()
|
||||
if av.c.DebugScanOutcome != "" {
|
||||
av.l.Warn().Str("antivir, clamav", ">>>>>>> ANTIVIRUS_DEBUG_SCAN_OUTCOME IS SET NO ACTUAL VIRUS SCAN IS PERFORMED!").Send()
|
||||
if err := events.Publish(ctx, s, events.PostprocessingStepFinished{
|
||||
FinishedStep: events.PPStepAntivirus,
|
||||
Outcome: events.PostprocessingOutcome(av.config.DebugScanOutcome),
|
||||
Outcome: events.PostprocessingOutcome(av.c.DebugScanOutcome),
|
||||
UploadID: ev.UploadID,
|
||||
ExecutingUser: ev.ExecutingUser,
|
||||
Filename: ev.Filename,
|
||||
@@ -174,14 +167,13 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
ResourceID: ev.ResourceID,
|
||||
},
|
||||
}); err != nil {
|
||||
av.log.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
|
||||
av.l.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
|
||||
return fmt.Errorf("%w: cannot publish events", ErrFatal)
|
||||
}
|
||||
return fmt.Errorf("%w: no actual virus scan performed", ErrEvent)
|
||||
}
|
||||
|
||||
av.log.Debug().Str("uploadid", ev.UploadID).Str("filename", ev.Filename).Msg("Starting virus scan.")
|
||||
|
||||
av.l.Debug().Str("uploadid", ev.UploadID).Str("filename", ev.Filename).Msg("Starting virus scan.")
|
||||
var errmsg string
|
||||
start := time.Now()
|
||||
res, err := av.process(ev)
|
||||
@@ -193,17 +185,17 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
var outcome events.PostprocessingOutcome
|
||||
switch {
|
||||
case res.Infected:
|
||||
outcome = av.outcome
|
||||
outcome = av.o
|
||||
case !res.Infected && err == nil:
|
||||
outcome = events.PPOutcomeContinue
|
||||
case err != nil:
|
||||
outcome = events.PPOutcomeRetry
|
||||
default:
|
||||
// Not sure what this is about. Abort.
|
||||
// Not sure what this is about. abort.
|
||||
outcome = events.PPOutcomeAbort
|
||||
}
|
||||
|
||||
av.log.Info().Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Str("virus", res.Description).Str("outcome", string(outcome)).Str("filename", ev.Filename).Str("user", ev.ExecutingUser.GetId().GetOpaqueId()).Bool("infected", res.Infected).Dur("duration", duration).Msg("File scanned")
|
||||
av.l.Info().Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Str("virus", res.Description).Str("outcome", string(outcome)).Str("filename", ev.Filename).Str("user", ev.ExecutingUser.GetId().GetOpaqueId()).Bool("infected", res.Infected).Dur("duration", duration).Msg("File scanned")
|
||||
if err := events.Publish(ctx, s, events.PostprocessingStepFinished{
|
||||
FinishedStep: events.PPStepAntivirus,
|
||||
Outcome: outcome,
|
||||
@@ -218,7 +210,7 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
ErrorMsg: errmsg,
|
||||
},
|
||||
}); err != nil {
|
||||
av.log.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
|
||||
av.l.Fatal().Err(err).Str("uploadid", ev.UploadID).Interface("resourceID", ev.ResourceID).Msg("cannot publish events - exiting")
|
||||
return fmt.Errorf("%w: %s", ErrFatal, err)
|
||||
}
|
||||
return nil
|
||||
@@ -226,24 +218,11 @@ func (av Antivirus) processEvent(e events.Event, s events.Publisher) error {
|
||||
|
||||
// process the scan
|
||||
func (av Antivirus) process(ev events.StartPostprocessingStep) (scanners.Result, error) {
|
||||
if ev.Filesize == 0 {
|
||||
av.log.Info().Str("uploadid", ev.UploadID).Msg("Skipping file to be virus scanned, file size is 0.")
|
||||
return scanners.Result{ScanTime: time.Now()}, nil
|
||||
}
|
||||
|
||||
headers := make(map[string]string)
|
||||
switch {
|
||||
case av.maxScanSize == 0:
|
||||
// there is no size limit
|
||||
break
|
||||
case av.config.MaxScanSizeMode == config.MaxScanSizeModeSkip && ev.Filesize > av.maxScanSize:
|
||||
// skip the file if it is bigger than the max scan size
|
||||
av.log.Info().Str("uploadid", ev.UploadID).Uint64("filesize", ev.Filesize).
|
||||
Msg("Skipping file to be virus scanned, file size is bigger than max scan size.")
|
||||
return scanners.Result{ScanTime: time.Now()}, nil
|
||||
case av.config.MaxScanSizeMode == config.MaxScanSizeModePartial && ev.Filesize > av.maxScanSize:
|
||||
// set the range header to only download the first maxScanSize bytes
|
||||
headers["Range"] = fmt.Sprintf("bytes=0-%d", av.maxScanSize-1)
|
||||
if ev.Filesize == 0 || (0 < av.m && av.m < ev.Filesize) {
|
||||
av.l.Info().Str("uploadid", ev.UploadID).Uint64("limit", av.m).Uint64("filesize", ev.Filesize).Msg("Skipping file to be virus scanned because its file size is higher than the defined limit.")
|
||||
return scanners.Result{
|
||||
ScanTime: time.Now(),
|
||||
}, nil
|
||||
}
|
||||
|
||||
var err error
|
||||
@@ -251,61 +230,56 @@ func (av Antivirus) process(ev events.StartPostprocessingStep) (scanners.Result,
|
||||
|
||||
switch ev.UploadID {
|
||||
default:
|
||||
rrc, err = av.downloadViaToken(ev.URL, headers)
|
||||
rrc, err = av.downloadViaToken(ev.URL)
|
||||
case "":
|
||||
rrc, err = av.downloadViaReva(ev.URL, ev.Token, ev.RevaToken, headers)
|
||||
rrc, err = av.downloadViaReva(ev.URL, ev.Token, ev.RevaToken)
|
||||
}
|
||||
if err != nil {
|
||||
av.log.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error downloading file")
|
||||
av.l.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error downloading file")
|
||||
return scanners.Result{}, err
|
||||
}
|
||||
defer func() {
|
||||
_ = rrc.Close()
|
||||
}()
|
||||
defer rrc.Close()
|
||||
av.l.Debug().Str("uploadid", ev.UploadID).Msg("Downloaded file successfully, starting virusscan")
|
||||
|
||||
av.log.Debug().Str("uploadid", ev.UploadID).Msg("Downloaded file successfully, starting virusscan")
|
||||
|
||||
res, err := av.scanner.Scan(scanners.Input{Body: rrc, Size: int64(ev.Filesize), Url: ev.URL, Name: ev.Filename})
|
||||
res, err := av.s.Scan(scanners.Input{Body: rrc, Size: int64(ev.Filesize), Url: ev.URL, Name: ev.Filename})
|
||||
if err != nil {
|
||||
av.log.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error scanning file")
|
||||
av.l.Error().Err(err).Str("uploadid", ev.UploadID).Msg("error scanning file")
|
||||
}
|
||||
|
||||
return res, err
|
||||
}
|
||||
|
||||
// download will download the file
|
||||
func (av Antivirus) downloadViaToken(url string, headers map[string]string) (io.ReadCloser, error) {
|
||||
func (av Antivirus) downloadViaToken(url string) (io.ReadCloser, error) {
|
||||
req, err := http.NewRequest(http.MethodGet, url, nil)
|
||||
if err != nil {
|
||||
return nil, err
|
||||
}
|
||||
|
||||
return av.doDownload(req, headers)
|
||||
return av.doDownload(req)
|
||||
}
|
||||
|
||||
// download will download the file
|
||||
func (av Antivirus) downloadViaReva(url string, dltoken string, revatoken string, headers map[string]string) (io.ReadCloser, error) {
|
||||
req, err := rhttp.NewRequest(ctxpkg.ContextSetToken(context.Background(), revatoken), http.MethodGet, url, nil)
|
||||
func (av Antivirus) downloadViaReva(url string, dltoken string, revatoken string) (io.ReadCloser, error) {
|
||||
ctx := ctxpkg.ContextSetToken(context.Background(), revatoken)
|
||||
|
||||
req, err := rhttp.NewRequest(ctx, http.MethodGet, url, nil)
|
||||
if err != nil {
|
||||
return nil, err
|
||||
}
|
||||
req.Header.Set("X-Reva-Transfer", dltoken)
|
||||
|
||||
return av.doDownload(req, headers)
|
||||
return av.doDownload(req)
|
||||
}
|
||||
|
||||
func (av Antivirus) doDownload(req *http.Request, headers map[string]string) (io.ReadCloser, error) {
|
||||
for k, v := range headers {
|
||||
req.Header.Add(k, v)
|
||||
}
|
||||
|
||||
func (av Antivirus) doDownload(req *http.Request) (io.ReadCloser, error) {
|
||||
res, err := av.client.Do(req)
|
||||
if err != nil {
|
||||
return nil, err
|
||||
}
|
||||
|
||||
if !slices.Contains([]int{http.StatusOK, http.StatusPartialContent}, res.StatusCode) {
|
||||
_ = res.Body.Close()
|
||||
if res.StatusCode != http.StatusOK {
|
||||
res.Body.Close()
|
||||
return nil, fmt.Errorf("unexpected status code from Download %v", res.StatusCode)
|
||||
}
|
||||
|
||||
|
||||
@@ -11,6 +11,7 @@ import (
|
||||
gateway "github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1"
|
||||
group "github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1"
|
||||
user "github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1"
|
||||
rpc "github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1"
|
||||
provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1"
|
||||
"go.opentelemetry.io/otel/trace"
|
||||
|
||||
@@ -218,16 +219,33 @@ func processShareEvent(ctx context.Context, ref *provider.Reference, gwc gateway
|
||||
|
||||
// custom logic for item trashed event
|
||||
func processItemTrashedEvent(ctx context.Context, ref *provider.Reference, gwc gateway.GatewayAPIClient, initiatorid string, itemID *provider.ResourceId) ([]string, FileEvent, error) {
|
||||
data := FileEvent{
|
||||
ItemID: storagespace.FormatResourceID(itemID),
|
||||
// TODO: check with web if parentID is needed
|
||||
// ParentItemID: storagespace.FormatResourceID(*item.GetRef().GetResourceId()),
|
||||
SpaceID: storagespace.FormatStorageID(itemID.GetStorageId(), itemID.GetSpaceId()),
|
||||
InitiatorID: initiatorid,
|
||||
resp, err := gwc.ListRecycle(ctx, &provider.ListRecycleRequest{
|
||||
Ref: ref,
|
||||
Key: itemID.GetOpaqueId(),
|
||||
})
|
||||
if err != nil {
|
||||
return nil, FileEvent{}, err
|
||||
}
|
||||
if resp.GetStatus().GetCode() != rpc.Code_CODE_OK {
|
||||
return nil, FileEvent{}, fmt.Errorf("error listing recycle: %s", resp.GetStatus().GetMessage())
|
||||
}
|
||||
|
||||
users, err := utils.GetSpaceMembers(ctx, itemID.GetSpaceId(), gwc, utils.ViewerRole)
|
||||
return users, data, err
|
||||
for _, item := range resp.GetRecycleItems() {
|
||||
if item.GetKey() == itemID.GetOpaqueId() {
|
||||
|
||||
data := FileEvent{
|
||||
ItemID: storagespace.FormatResourceID(itemID),
|
||||
// TODO: check with web if parentID is needed
|
||||
// ParentItemID: storagespace.FormatResourceID(*item.GetRef().GetResourceId()),
|
||||
SpaceID: storagespace.FormatStorageID(itemID.GetStorageId(), itemID.GetSpaceId()),
|
||||
InitiatorID: initiatorid,
|
||||
}
|
||||
|
||||
users, err := utils.GetSpaceMembers(ctx, itemID.GetSpaceId(), gwc, utils.ViewerRole)
|
||||
return users, data, err
|
||||
}
|
||||
}
|
||||
return nil, FileEvent{}, errors.New("item not found in recycle bin")
|
||||
}
|
||||
|
||||
// adds share related data to the FileEvent
|
||||
|
||||
@@ -1272,10 +1272,6 @@ func (f *FileConnector) CheckFileInfo(ctx context.Context) (*ConnectorResponse,
|
||||
|
||||
fileinfo.KeyPostMessageOrigin: f.cfg.Commons.OpenCloudURL,
|
||||
fileinfo.KeyLicenseCheckForEditIsEnabled: f.cfg.App.LicenseCheckEnable,
|
||||
|
||||
// set to true for Collabora until we have a web embed mode for "Save As" and "Export As"
|
||||
// see the FIXME in ./fileinfo/collabora.go and https://github.com/opencloud-eu/web/issues/422
|
||||
fileinfo.KeyUserCanNotWriteRelative: false,
|
||||
}
|
||||
|
||||
switch wopiContext.ViewMode {
|
||||
|
||||
@@ -1780,7 +1780,7 @@ var _ = Describe("FileConnector", func() {
|
||||
OwnerID: "61616262636340637573746f6d496470", // hex of aabbcc@customIdp
|
||||
Size: int64(998877),
|
||||
BaseFileName: "test.txt",
|
||||
UserCanNotWriteRelative: true,
|
||||
UserCanNotWriteRelative: false,
|
||||
DisableExport: true,
|
||||
DisableCopy: true,
|
||||
DisablePrint: true,
|
||||
@@ -1962,7 +1962,7 @@ var _ = Describe("FileConnector", func() {
|
||||
OwnerID: "61616262636340637573746f6d496470", // hex of aabbcc@customIdp
|
||||
Size: int64(998877),
|
||||
BaseFileName: "test.txt",
|
||||
UserCanNotWriteRelative: true,
|
||||
UserCanNotWriteRelative: false,
|
||||
DisableExport: true,
|
||||
DisableCopy: true,
|
||||
DisablePrint: true,
|
||||
|
||||
@@ -99,7 +99,7 @@ func (cinfo *Collabora) SetProperties(props map[string]interface{}) {
|
||||
case KeyUserCanWrite:
|
||||
cinfo.UserCanWrite = value.(bool)
|
||||
case KeyUserCanNotWriteRelative:
|
||||
cinfo.UserCanNotWriteRelative = true // FIXME: set to `value.(bool)` again for https://github.com/opencloud-eu/web/issues/422
|
||||
cinfo.UserCanNotWriteRelative = value.(bool)
|
||||
case KeyUserID:
|
||||
cinfo.UserID = value.(string)
|
||||
case KeyUserFriendlyName:
|
||||
|
||||
@@ -83,7 +83,6 @@ func NewDriveItemPermissionsService(logger log.Logger, gatewaySelector pool.Sele
|
||||
gatewaySelector: gatewaySelector,
|
||||
identityCache: identityCache,
|
||||
config: config,
|
||||
availableRoles: unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(config.UnifiedRoles.AvailableRoles...)),
|
||||
},
|
||||
}, nil
|
||||
}
|
||||
|
||||
@@ -441,6 +441,7 @@ var _ = Describe("DriveItemPermissionsService", func() {
|
||||
})
|
||||
It("returns role denied", func() {
|
||||
statResponse.Info.PermissionSet = roleconversions.NewManagerRole().CS3ResourcePermissions()
|
||||
cfg.UnifiedRoles.AvailableRoles = []string{unifiedrole.UnifiedRoleViewerID, unifiedrole.UnifiedRoleDeniedID, unifiedrole.UnifiedRoleManagerID}
|
||||
listSharesResponse.Shares = []*collaboration.Share{
|
||||
{
|
||||
Id: &collaboration.ShareId{OpaqueId: "1"},
|
||||
@@ -464,15 +465,11 @@ var _ = Describe("DriveItemPermissionsService", func() {
|
||||
}
|
||||
listPublicSharesResponse.Share = []*link.PublicShare{}
|
||||
|
||||
cfg = defaults.FullDefaultConfig()
|
||||
cfg.UnifiedRoles.AvailableRoles = []string{unifiedrole.UnifiedRoleViewerID, unifiedrole.UnifiedRoleDeniedID, unifiedrole.UnifiedRoleManagerID}
|
||||
service, err := svc.NewDriveItemPermissionsService(log.NewLogger(), gatewaySelector, cache, cfg)
|
||||
|
||||
gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil)
|
||||
gatewayClient.On("ListShares", mock.Anything, mock.Anything).Return(listSharesResponse, nil)
|
||||
gatewayClient.On("GetUser", mock.Anything, mock.Anything).Return(getUserResponse, nil)
|
||||
gatewayClient.On("ListPublicShares", mock.Anything, mock.Anything).Return(listPublicSharesResponse, nil)
|
||||
permissions, err := service.ListPermissions(context.Background(), itemID, false, false)
|
||||
permissions, err := driveItemPermissionsService.ListPermissions(context.Background(), itemID, false, false)
|
||||
Expect(err).ToNot(HaveOccurred())
|
||||
Expect(len(permissions.LibreGraphPermissionsActionsAllowedValues)).ToNot(BeZero())
|
||||
Expect(len(permissions.LibreGraphPermissionsRolesAllowedValues)).ToNot(BeZero())
|
||||
|
||||
@@ -46,7 +46,6 @@ type BaseGraphService struct {
|
||||
gatewaySelector pool.Selectable[gateway.GatewayAPIClient]
|
||||
identityCache identity.IdentityCache
|
||||
config *config.Config
|
||||
availableRoles []*libregraph.UnifiedRoleDefinition
|
||||
}
|
||||
|
||||
func (g BaseGraphService) getSpaceRootPermissions(ctx context.Context, spaceID *storageprovider.StorageSpaceId) ([]libregraph.Permission, error) {
|
||||
@@ -87,7 +86,8 @@ func (g BaseGraphService) CS3ReceivedSharesToDriveItems(ctx context.Context, rec
|
||||
return nil, err
|
||||
}
|
||||
|
||||
return cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, g.availableRoles)
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
return cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, availableRoles)
|
||||
}
|
||||
|
||||
func (g BaseGraphService) CS3ReceivedOCMSharesToDriveItems(ctx context.Context, receivedShares []*ocm.ReceivedShare) ([]libregraph.DriveItem, error) {
|
||||
@@ -96,7 +96,8 @@ func (g BaseGraphService) CS3ReceivedOCMSharesToDriveItems(ctx context.Context,
|
||||
return nil, err
|
||||
}
|
||||
|
||||
return cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, g.availableRoles)
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
return cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, receivedShares, availableRoles)
|
||||
}
|
||||
|
||||
func (g BaseGraphService) cs3SpacePermissionsToLibreGraph(ctx context.Context, space *storageprovider.StorageSpace, apiVersion APIVersion) []libregraph.Permission {
|
||||
@@ -195,8 +196,9 @@ func (g BaseGraphService) cs3SpacePermissionsToLibreGraph(ctx context.Context, s
|
||||
p.SetExpirationDateTime(time.Unix(int64(exp.GetSeconds()), int64(exp.GetNanos())))
|
||||
}
|
||||
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
if role := unifiedrole.CS3ResourcePermissionsToRole(
|
||||
g.availableRoles,
|
||||
availableRoles,
|
||||
perm,
|
||||
unifiedrole.UnifiedRoleConditionDrive,
|
||||
false,
|
||||
@@ -599,7 +601,7 @@ func (g BaseGraphService) cs3UserShareToPermission(ctx context.Context, share *c
|
||||
perm.SetCreatedDateTime(cs3TimestampToTime(share.GetCtime()))
|
||||
}
|
||||
role := unifiedrole.CS3ResourcePermissionsToRole(
|
||||
g.availableRoles,
|
||||
unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...)),
|
||||
share.GetPermissions().GetPermissions(),
|
||||
roleCondition,
|
||||
false,
|
||||
@@ -687,8 +689,9 @@ func (g BaseGraphService) cs3OCMShareToPermission(ctx context.Context, share *oc
|
||||
}
|
||||
}
|
||||
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
role := unifiedrole.CS3ResourcePermissionsToRole(
|
||||
g.availableRoles,
|
||||
availableRoles,
|
||||
permissions,
|
||||
roleCondition,
|
||||
true,
|
||||
|
||||
@@ -14,7 +14,7 @@ import (
|
||||
// GetRoleDefinitions a list of permission roles than can be used when sharing with users or groups
|
||||
func (g Graph) GetRoleDefinitions(w http.ResponseWriter, r *http.Request) {
|
||||
render.Status(r, http.StatusOK)
|
||||
render.JSON(w, r, g.availableRoles)
|
||||
render.JSON(w, r, unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...)))
|
||||
}
|
||||
|
||||
// GetRoleDefinition a permission role than can be used when sharing with users or groups
|
||||
|
||||
@@ -31,7 +31,6 @@ import (
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/identity"
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/identity/ldap"
|
||||
graphm "github.com/opencloud-eu/opencloud/services/graph/pkg/middleware"
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/unifiedrole"
|
||||
)
|
||||
|
||||
const (
|
||||
@@ -149,7 +148,6 @@ func NewService(opts ...Option) (Graph, error) { //nolint:maintidx
|
||||
identityCache: identityCache,
|
||||
gatewaySelector: options.GatewaySelector,
|
||||
config: options.Config,
|
||||
availableRoles: unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(options.Config.UnifiedRoles.AvailableRoles...)),
|
||||
},
|
||||
mux: m,
|
||||
specialDriveItemsCache: spacePropertiesCache,
|
||||
|
||||
@@ -10,6 +10,7 @@ import (
|
||||
libregraph "github.com/owncloud/libre-graph-api-go"
|
||||
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/errorcode"
|
||||
"github.com/opencloud-eu/opencloud/services/graph/pkg/unifiedrole"
|
||||
)
|
||||
|
||||
// ListSharedWithMe lists the files shared with the current user.
|
||||
@@ -39,7 +40,8 @@ func (g Graph) listSharedWithMe(ctx context.Context) ([]libregraph.DriveItem, er
|
||||
g.logger.Error().Err(err).Msg("listing shares failed")
|
||||
return nil, err
|
||||
}
|
||||
driveItems, err := cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedSharesResponse.GetShares(), g.availableRoles)
|
||||
availableRoles := unifiedrole.GetRoles(unifiedrole.RoleFilterIDs(g.config.UnifiedRoles.AvailableRoles...))
|
||||
driveItems, err := cs3ReceivedSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedSharesResponse.GetShares(), availableRoles)
|
||||
if err != nil {
|
||||
g.logger.Error().Err(err).Msg("could not convert received shares to drive items")
|
||||
return nil, err
|
||||
@@ -51,7 +53,7 @@ func (g Graph) listSharedWithMe(ctx context.Context) ([]libregraph.DriveItem, er
|
||||
g.logger.Error().Err(err).Msg("listing shares failed")
|
||||
return nil, err
|
||||
}
|
||||
ocmDriveItems, err := cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedOCMSharesResponse.GetShares(), g.availableRoles)
|
||||
ocmDriveItems, err := cs3ReceivedOCMSharesToDriveItems(ctx, g.logger, gatewayClient, g.identityCache, listReceivedOCMSharesResponse.GetShares(), availableRoles)
|
||||
if err != nil {
|
||||
g.logger.Error().Err(err).Msg("could not convert received ocm shares to drive items")
|
||||
return nil, err
|
||||
|
||||
@@ -17,16 +17,15 @@ node-generate-prod: assets
|
||||
.PHONY: assets
|
||||
assets: pnpm-build \
|
||||
assets/identifier/static \
|
||||
assets/identifier/static/favicon.svg \
|
||||
assets/identifier/static/favicon.ico \
|
||||
assets/identifier/static/icon-lilac.svg
|
||||
|
||||
assets/identifier/static:
|
||||
mkdir -p assets/identifier/static
|
||||
|
||||
.PHONY: assets/identifier/static/favicon.svg # force overwrite
|
||||
assets/identifier/static/favicon.svg:
|
||||
cp src/images/favicon.svg assets/identifier/static/favicon.svg
|
||||
rm assets/identifier/static/favicon.ico
|
||||
.PHONY: assets/identifier/static/favicon.ico # force overwrite
|
||||
assets/identifier/static/favicon.ico:
|
||||
cp src/images/favicon.ico assets/identifier/static/favicon.ico
|
||||
|
||||
.PHONY: assets/identifier/static/icon-lilac.svg
|
||||
assets/identifier/static/icon-lilac.svg:
|
||||
|
||||
@@ -7,76 +7,3 @@ It is mainly targeted at smaller installations. For larger setups it is recommen
|
||||
By default, it is configured to use the OpenCloud IDM service as its LDAP backend for looking up and authenticating users. Other backends like an external LDAP server can be configured via a set of [enviroment variables](https://docs.opencloud.eu/services/idp/configuration/#environment-variables).
|
||||
|
||||
Note that translations provided by the IDP service are not maintained via OpenCloud but part of the embedded [LibreGraph Connect Identifier](https://github.com/libregraph/lico/tree/master/identifier) package.
|
||||
|
||||
## Configuration
|
||||
|
||||
### Custom Clients
|
||||
|
||||
By default the `idp` service generates a OIDC client configuration suitable for
|
||||
using OpenCloud with the standard client applications (Web, Desktop, iOS and
|
||||
Android). If you need to configure additional client it is possible to inject a
|
||||
custom configuration via `yaml`. This can be done by adding a section `clients`
|
||||
to the `idp` section of the main configuration file (`opencloud.yaml`). This section
|
||||
needs to contain configuration for all clients (including the standard clients).
|
||||
|
||||
For example if you want to add a (public) client for use with the oidc-agent you would
|
||||
need to add this snippet to the `idp` section in `opencloud.yaml`.
|
||||
|
||||
```yaml
|
||||
clients:
|
||||
- id: web
|
||||
name: OpenCloud Web App
|
||||
trusted: true
|
||||
secret: ""
|
||||
redirect_uris:
|
||||
- https://opencloud.k8s:9200/
|
||||
- https://opencloud.k8s:9200/oidc-callback.html
|
||||
- https://opencloud.k8s:9200/oidc-silent-redirect.html
|
||||
post_logout_redirect_uris: []
|
||||
origins:
|
||||
- https://opencloud.k8s:9200
|
||||
application_type: ""
|
||||
- id: OpenCloudDesktop
|
||||
name: OpenCloud Desktop Client
|
||||
trusted: false
|
||||
secret: ""
|
||||
redirect_uris:
|
||||
- http://127.0.0.1
|
||||
- http://localhost
|
||||
post_logout_redirect_uris: []
|
||||
origins: []
|
||||
application_type: native
|
||||
- id: OpenCloudAndroid
|
||||
name: OpenCloud Android App
|
||||
trusted: false
|
||||
secret: ""
|
||||
redirect_uris:
|
||||
- oc://android.opencloud.eu
|
||||
post_logout_redirect_uris:
|
||||
- oc://android.opencloud.eu
|
||||
origins: []
|
||||
application_type: native
|
||||
- id: OpenCloudIOS
|
||||
name: OpenCloud iOS App
|
||||
trusted: false
|
||||
secret: ""
|
||||
redirect_uris:
|
||||
- oc://ios.opencloud.eu
|
||||
post_logout_redirect_uris:
|
||||
- oc://ios.opencloud.eu
|
||||
origins: []
|
||||
application_type: native
|
||||
- id: oidc-agent
|
||||
name: OIDC Agent
|
||||
trusted: false
|
||||
secret: ""
|
||||
redirect_uris:
|
||||
- http://127.0.0.1
|
||||
- http://localhost
|
||||
post_logout_redirect_uris: []
|
||||
origins: []
|
||||
application_type: native
|
||||
```
|
||||
|
||||
|
||||
|
||||
|
||||
@@ -102,7 +102,7 @@
|
||||
"redux-logger": "^3.0.6",
|
||||
"redux-thunk": "^2.4.2",
|
||||
"render-if": "^0.1.1",
|
||||
"web-vitals": "^4.2.4"
|
||||
"web-vitals": "^3.5.2"
|
||||
},
|
||||
"devDependencies": {
|
||||
"@babel/core": "7.26.10",
|
||||
@@ -125,7 +125,7 @@
|
||||
"eslint-plugin-i18next": "^6.1.1",
|
||||
"eslint-plugin-import": "^2.30.0",
|
||||
"eslint-plugin-jest": "^24.7.0",
|
||||
"eslint-plugin-jsx-a11y": "^6.10.2",
|
||||
"eslint-plugin-jsx-a11y": "^6.9.0",
|
||||
"eslint-plugin-react": "^7.37.2",
|
||||
"eslint-plugin-react-hooks": "^4.6.2",
|
||||
"eslint-plugin-testing-library": "^3.10.2",
|
||||
|
||||
1091
services/idp/pnpm-lock.yaml
generated
1091
services/idp/pnpm-lock.yaml
generated
File diff suppressed because it is too large
Load Diff
@@ -4,7 +4,7 @@
|
||||
<meta charset="utf-8">
|
||||
<meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no">
|
||||
<meta name="theme-color" content="#1b223d">
|
||||
<link rel="icon" href="%PUBLIC_URL%/static/favicon.svg" type="image/svg+xml">
|
||||
<link rel="shortcut icon" href="%PUBLIC_URL%/static/favicon.ico" type="image/x-icon">
|
||||
<meta property="csp-nonce" content="__CSP_NONCE__">
|
||||
<title>Sign in - OpenCloud</title>
|
||||
</head>
|
||||
|
||||
BIN
services/idp/src/images/favicon.ico
Normal file
BIN
services/idp/src/images/favicon.ico
Normal file
Binary file not shown.
|
After Width: | Height: | Size: 15 KiB |
@@ -1,3 +0,0 @@
|
||||
<svg xmlns="http://www.w3.org/2000/svg" version="1.1" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:svgjs="http://svgjs.dev/svgjs" width="512" height="512"><svg id="SvgjsSvg1001" xmlns="http://www.w3.org/2000/svg" width="512" height="512" viewBox="0 0 512 512"><rect x=".02" y="0" width="512" height="512" fill="#20434f"></rect><polygon points="255.98 342.75 271.89 333.57 271.89 267.12 329.08 234.1 329.08 215.78 313.18 206.6 255.6 239.84 198.83 207.06 182.93 216.24 182.93 234.56 240.12 267.58 240.12 333.59 255.98 342.75" fill="#e2baff"></polygon><polygon points="401.95 150.82 256 66.56 256 66.56 256 66.56 110.05 150.82 110.05 187.5 256 103.24 401.95 187.5 401.95 150.82" fill="#e2baff"></polygon><polygon points="401.95 324.5 256 408.76 110.06 324.5 110.06 361.17 256 445.43 256 445.43 256 445.43 401.95 361.17 401.95 324.5" fill="#e2baff"></polygon></svg><style>@media (prefers-color-scheme: light) { :root { filter: none; } }
|
||||
@media (prefers-color-scheme: dark) { :root { filter: none; } }
|
||||
</style></svg>
|
||||
|
Before Width: | Height: | Size: 1015 B |
@@ -21,19 +21,19 @@ var (
|
||||
func NewTextTemplate(mt MessageTemplate, locale, defaultLocale string, translationPath string, vars map[string]string) (MessageTemplate, error) {
|
||||
var err error
|
||||
t := l10n.NewTranslatorFromCommonConfig(defaultLocale, _domain, translationPath, _translationFS, "l10n/locale").Locale(locale)
|
||||
mt.Subject, err = composeMessage(t.Get(mt.Subject, []interface{}{}...), vars)
|
||||
mt.Subject, err = composeMessage(t.Get("%s", mt.Subject), vars)
|
||||
if err != nil {
|
||||
return mt, err
|
||||
}
|
||||
mt.Greeting, err = composeMessage(t.Get(mt.Greeting, []interface{}{}...), vars)
|
||||
mt.Greeting, err = composeMessage(t.Get("%s", mt.Greeting), vars)
|
||||
if err != nil {
|
||||
return mt, err
|
||||
}
|
||||
mt.MessageBody, err = composeMessage(t.Get(mt.MessageBody, []interface{}{}...), vars)
|
||||
mt.MessageBody, err = composeMessage(t.Get("%s", mt.MessageBody), vars)
|
||||
if err != nil {
|
||||
return mt, err
|
||||
}
|
||||
mt.CallToAction, err = composeMessage(t.Get(mt.CallToAction, []interface{}{}...), vars)
|
||||
mt.CallToAction, err = composeMessage(t.Get("%s", mt.CallToAction), vars)
|
||||
if err != nil {
|
||||
return mt, err
|
||||
}
|
||||
@@ -44,19 +44,19 @@ func NewTextTemplate(mt MessageTemplate, locale, defaultLocale string, translati
|
||||
func NewHTMLTemplate(mt MessageTemplate, locale, defaultLocale string, translationPath string, vars map[string]string) (MessageTemplate, error) {
|
||||
var err error
|
||||
t := l10n.NewTranslatorFromCommonConfig(defaultLocale, _domain, translationPath, _translationFS, "l10n/locale").Locale(locale)
|
||||
mt.Subject, err = composeMessage(t.Get(mt.Subject, []interface{}{}...), vars)
|
||||
mt.Subject, err = composeMessage(t.Get("%s", mt.Subject), vars)
|
||||
if err != nil {
|
||||
return mt, err
|
||||
}
|
||||
mt.Greeting, err = composeMessage(newlineToBr(t.Get(mt.Greeting, []interface{}{}...)), vars)
|
||||
mt.Greeting, err = composeMessage(newlineToBr(t.Get("%s", mt.Greeting)), vars)
|
||||
if err != nil {
|
||||
return mt, err
|
||||
}
|
||||
mt.MessageBody, err = composeMessage(newlineToBr(t.Get(mt.MessageBody, []interface{}{}...)), vars)
|
||||
mt.MessageBody, err = composeMessage(newlineToBr(t.Get("%s", mt.MessageBody)), vars)
|
||||
if err != nil {
|
||||
return mt, err
|
||||
}
|
||||
mt.CallToAction, err = composeMessage(callToActionToHTML(t.Get(mt.CallToAction, []interface{}{}...)), vars)
|
||||
mt.CallToAction, err = composeMessage(callToActionToHTML(t.Get("%s", mt.CallToAction)), vars)
|
||||
if err != nil {
|
||||
return mt, err
|
||||
}
|
||||
@@ -71,18 +71,18 @@ func NewGroupedTextTemplate(gmt GroupedMessageTemplate, vars map[string]string,
|
||||
|
||||
var err error
|
||||
t := l10n.NewTranslatorFromCommonConfig(defaultLocale, _domain, translationPath, _translationFS, "l10n/locale").Locale(locale)
|
||||
gmt.Subject, err = composeMessage(t.Get(gmt.Subject, []interface{}{}...), vars)
|
||||
gmt.Subject, err = composeMessage(t.Get("%s", gmt.Subject), vars)
|
||||
if err != nil {
|
||||
return gmt, err
|
||||
}
|
||||
gmt.Greeting, err = composeMessage(t.Get(gmt.Greeting, []interface{}{}...), vars)
|
||||
gmt.Greeting, err = composeMessage(t.Get("%s", gmt.Greeting), vars)
|
||||
if err != nil {
|
||||
return gmt, err
|
||||
}
|
||||
|
||||
bodyParts := make([]string, 0, len(mtsVars))
|
||||
for i, mt := range mts {
|
||||
bodyPart, err := composeMessage(t.Get(mt.MessageBody, []interface{}{}...), mtsVars[i])
|
||||
bodyPart, err := composeMessage(t.Get("%s", mt.MessageBody), mtsVars[i])
|
||||
if err != nil {
|
||||
return gmt, err
|
||||
}
|
||||
@@ -100,18 +100,18 @@ func NewGroupedHTMLTemplate(gmt GroupedMessageTemplate, vars map[string]string,
|
||||
|
||||
var err error
|
||||
t := l10n.NewTranslatorFromCommonConfig(defaultLocale, _domain, translationPath, _translationFS, "l10n/locale").Locale(locale)
|
||||
gmt.Subject, err = composeMessage(t.Get(gmt.Subject, []interface{}{}...), vars)
|
||||
gmt.Subject, err = composeMessage(t.Get("%s", gmt.Subject), vars)
|
||||
if err != nil {
|
||||
return gmt, err
|
||||
}
|
||||
gmt.Greeting, err = composeMessage(newlineToBr(t.Get(gmt.Greeting, []interface{}{}...)), vars)
|
||||
gmt.Greeting, err = composeMessage(newlineToBr(t.Get("%s", gmt.Greeting)), vars)
|
||||
if err != nil {
|
||||
return gmt, err
|
||||
}
|
||||
|
||||
bodyParts := make([]string, 0, len(mtsVars))
|
||||
for i, mt := range mts {
|
||||
bodyPart, err := composeMessage(t.Get(mt.MessageBody, []interface{}{}...), mtsVars[i])
|
||||
bodyPart, err := composeMessage(t.Get("%s", mt.MessageBody), mtsVars[i])
|
||||
if err != nil {
|
||||
return gmt, err
|
||||
}
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -697,7 +697,7 @@ func translateBundle(bundle *settingsmsg.Bundle, t *gotext.Locale) *settingsmsg.
|
||||
// translate interval names ('Instant', 'Daily', 'Weekly', 'Never')
|
||||
value := set.GetSingleChoiceValue()
|
||||
for i, v := range value.GetOptions() {
|
||||
value.Options[i].DisplayValue = t.Get(v.GetDisplayValue(), []interface{}{}...)
|
||||
value.Options[i].DisplayValue = t.Get("%s", v.GetDisplayValue())
|
||||
}
|
||||
set.Value = &settingsmsg.Setting_SingleChoiceValue{SingleChoiceValue: value}
|
||||
fallthrough
|
||||
@@ -710,9 +710,9 @@ func translateBundle(bundle *settingsmsg.Bundle, t *gotext.Locale) *settingsmsg.
|
||||
defaults.SettingUUIDProfileEventSpaceDisabled,
|
||||
defaults.SettingUUIDProfileEventSpaceDeleted:
|
||||
// translate event names ('Share Received', 'Share Removed', ...)
|
||||
set.DisplayName = t.Get(set.GetDisplayName(), []interface{}{}...)
|
||||
set.DisplayName = t.Get("%s", set.GetDisplayName())
|
||||
// translate event descriptions ('Notify me when I receive a share', ...)
|
||||
set.Description = t.Get(set.GetDescription(), []interface{}{}...)
|
||||
set.Description = t.Get("%s", set.GetDescription())
|
||||
bundle.Settings[i] = set
|
||||
}
|
||||
}
|
||||
|
||||
@@ -1,4 +1,4 @@
|
||||
// Code generated by mockery v2.53.2. DO NOT EDIT.
|
||||
// Code generated by mockery v2.53.0. DO NOT EDIT.
|
||||
|
||||
package mocks
|
||||
|
||||
|
||||
@@ -108,7 +108,7 @@ func ListUploadSessions(cfg *config.Config) *cli.Command {
|
||||
var fsStream events.Stream
|
||||
if cfg.Driver == "posix" {
|
||||
// We need to init the posix driver with 'scanfs' disabled
|
||||
drivers["posix"] = revaconfig.Posix(cfg, false, false)
|
||||
drivers["posix"] = revaconfig.Posix(cfg, false)
|
||||
// Also posix refuses to start without an events stream
|
||||
fsStream, err = event.NewStream(cfg)
|
||||
if err != nil {
|
||||
|
||||
@@ -85,7 +85,7 @@ func Local(cfg *config.Config) map[string]interface{} {
|
||||
}
|
||||
|
||||
// Posix is the config mapping for the Posix storage driver
|
||||
func Posix(cfg *config.Config, enableFSScan, enableFSWatch bool) map[string]interface{} {
|
||||
func Posix(cfg *config.Config, enableFSScan bool) map[string]interface{} {
|
||||
return map[string]interface{}{
|
||||
"root": cfg.Drivers.Posix.Root,
|
||||
"personalspacepath_template": cfg.Drivers.Posix.PersonalSpacePathTemplate,
|
||||
@@ -137,7 +137,7 @@ func Posix(cfg *config.Config, enableFSScan, enableFSWatch bool) map[string]inte
|
||||
"use_space_groups": cfg.Drivers.Posix.UseSpaceGroups,
|
||||
"enable_fs_revisions": cfg.Drivers.Posix.EnableFSRevisions,
|
||||
"scan_fs": enableFSScan,
|
||||
"watch_fs": enableFSWatch,
|
||||
"watch_fs": cfg.Drivers.Posix.WatchFS,
|
||||
"watch_type": cfg.Drivers.Posix.WatchType,
|
||||
"watch_path": cfg.Drivers.Posix.WatchPath,
|
||||
"watch_folder_kafka_brokers": cfg.Drivers.Posix.WatchFolderKafkaBrokers,
|
||||
|
||||
@@ -16,7 +16,7 @@ func StorageProviderDrivers(cfg *config.Config) map[string]interface{} {
|
||||
"decomposed": DecomposedNoEvents(cfg),
|
||||
"s3": S3(cfg),
|
||||
"decomposeds3": DecomposedS3NoEvents(cfg),
|
||||
"posix": Posix(cfg, true, cfg.Drivers.Posix.WatchFS),
|
||||
"posix": Posix(cfg, true),
|
||||
|
||||
"ocis": Decomposed(cfg), // deprecated: use decomposed
|
||||
"s3ng": DecomposedS3NoEvents(cfg), // deprecated: use decomposeds3
|
||||
@@ -36,7 +36,7 @@ func DataProviderDrivers(cfg *config.Config) map[string]interface{} {
|
||||
"decomposed": Decomposed(cfg),
|
||||
"s3": S3(cfg),
|
||||
"decomposeds3": DecomposedS3(cfg),
|
||||
"posix": Posix(cfg, false, false),
|
||||
"posix": Posix(cfg, false),
|
||||
|
||||
"ocis": Decomposed(cfg), // deprecated: use decomposed
|
||||
"s3ng": DecomposedS3NoEvents(cfg), // deprecated: use decomposeds3
|
||||
|
||||
@@ -376,7 +376,7 @@ func composeMessage(nt NotificationTemplate, locale, defaultLocale, path string,
|
||||
|
||||
func loadTemplates(nt NotificationTemplate, locale, defaultLocale, path string) (string, string) {
|
||||
t := l10n.NewTranslatorFromCommonConfig(defaultLocale, _domain, path, _translationFS, "l10n/locale").Locale(locale)
|
||||
return t.Get(nt.Subject, []interface{}{}...), t.Get(nt.Message, []interface{}{}...)
|
||||
return t.Get("%s", nt.Subject), t.Get("%s", nt.Message)
|
||||
}
|
||||
|
||||
func executeTemplate(raw string, vars map[string]interface{}) (string, error) {
|
||||
|
||||
@@ -1,6 +1,6 @@
|
||||
SHELL := bash
|
||||
NAME := web
|
||||
WEB_ASSETS_VERSION = v2.2.0
|
||||
WEB_ASSETS_VERSION = v2.0.0
|
||||
WEB_ASSETS_BRANCH = main
|
||||
|
||||
ifneq (, $(shell command -v go 2> /dev/null)) # suppress `command not found warnings` for non go targets in CI
|
||||
|
||||
BIN
services/web/assets/themes/opencloud-dev/assets/favicon.ico
Normal file
BIN
services/web/assets/themes/opencloud-dev/assets/favicon.ico
Normal file
Binary file not shown.
|
After Width: | Height: | Size: 15 KiB |
@@ -1,3 +0,0 @@
|
||||
<svg xmlns="http://www.w3.org/2000/svg" version="1.1" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:svgjs="http://svgjs.dev/svgjs" width="512" height="512"><svg id="SvgjsSvg1001" xmlns="http://www.w3.org/2000/svg" width="512" height="512" viewBox="0 0 512 512"><rect x=".02" y="0" width="512" height="512" fill="#20434f"></rect><polygon points="255.98 342.75 271.89 333.57 271.89 267.12 329.08 234.1 329.08 215.78 313.18 206.6 255.6 239.84 198.83 207.06 182.93 216.24 182.93 234.56 240.12 267.58 240.12 333.59 255.98 342.75" fill="#e2baff"></polygon><polygon points="401.95 150.82 256 66.56 256 66.56 256 66.56 110.05 150.82 110.05 187.5 256 103.24 401.95 187.5 401.95 150.82" fill="#e2baff"></polygon><polygon points="401.95 324.5 256 408.76 110.06 324.5 110.06 361.17 256 445.43 256 445.43 256 445.43 401.95 361.17 401.95 324.5" fill="#e2baff"></polygon></svg><style>@media (prefers-color-scheme: light) { :root { filter: none; } }
|
||||
@media (prefers-color-scheme: dark) { :root { filter: none; } }
|
||||
</style></svg>
|
||||
|
Before Width: | Height: | Size: 1015 B |
@@ -43,7 +43,7 @@
|
||||
}
|
||||
},
|
||||
"logo": "themes/opencloud-dev/assets/logo.svg",
|
||||
"favicon": "themes/opencloud-dev/assets/favicon.svg"
|
||||
"favicon": "themes/opencloud-dev/assets/favicon.jpg"
|
||||
},
|
||||
"themes": [
|
||||
{
|
||||
|
||||
BIN
services/web/assets/themes/opencloud/assets/favicon.ico
Normal file
BIN
services/web/assets/themes/opencloud/assets/favicon.ico
Normal file
Binary file not shown.
|
After Width: | Height: | Size: 15 KiB |
@@ -1,3 +0,0 @@
|
||||
<svg xmlns="http://www.w3.org/2000/svg" version="1.1" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:svgjs="http://svgjs.dev/svgjs" width="512" height="512"><svg id="SvgjsSvg1001" xmlns="http://www.w3.org/2000/svg" width="512" height="512" viewBox="0 0 512 512"><rect x=".02" y="0" width="512" height="512" fill="#20434f"></rect><polygon points="255.98 342.75 271.89 333.57 271.89 267.12 329.08 234.1 329.08 215.78 313.18 206.6 255.6 239.84 198.83 207.06 182.93 216.24 182.93 234.56 240.12 267.58 240.12 333.59 255.98 342.75" fill="#e2baff"></polygon><polygon points="401.95 150.82 256 66.56 256 66.56 256 66.56 110.05 150.82 110.05 187.5 256 103.24 401.95 187.5 401.95 150.82" fill="#e2baff"></polygon><polygon points="401.95 324.5 256 408.76 110.06 324.5 110.06 361.17 256 445.43 256 445.43 256 445.43 401.95 361.17 401.95 324.5" fill="#e2baff"></polygon></svg><style>@media (prefers-color-scheme: light) { :root { filter: none; } }
|
||||
@media (prefers-color-scheme: dark) { :root { filter: none; } }
|
||||
</style></svg>
|
||||
|
Before Width: | Height: | Size: 1015 B |
@@ -50,7 +50,7 @@
|
||||
"web": {
|
||||
"defaults": {
|
||||
"logo": "themes/opencloud/assets/logo.svg",
|
||||
"favicon": "themes/opencloud/assets/favicon.svg",
|
||||
"favicon": "themes/opencloud/assets/favicon.ico",
|
||||
"designTokens": {
|
||||
"breakpoints": {
|
||||
"xsmall-max": "",
|
||||
@@ -94,9 +94,9 @@
|
||||
"label": "Light Theme",
|
||||
"designTokens": {
|
||||
"roles": {
|
||||
"primary": "#E2BAFF",
|
||||
"primary": "#07677F",
|
||||
"surfaceTint": "#07677F",
|
||||
"onPrimary": "#19353F",
|
||||
"onPrimary": "#FFFFFF",
|
||||
"primaryContainer": "#B7EAFF",
|
||||
"onPrimaryContainer": "#001F28",
|
||||
"secondary": "#20434f",
|
||||
|
||||
@@ -193,6 +193,25 @@
|
||||
- [apiServiceAvailability/serviceAvailabilityCheck.feature:125](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiServiceAvailability/serviceAvailabilityCheck.feature#L125)
|
||||
|
||||
#### [Skip tests for different languages](https://github.com/opencloud-eu/opencloud/issues/183)
|
||||
- [apiAntivirus/antivirus.feature:309](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiAntivirus/antivirus.feature#L309)
|
||||
- [apiAntivirus/antivirus.feature:310](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiAntivirus/antivirus.feature#L310)
|
||||
- [apiAntivirus/antivirus.feature:311](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiAntivirus/antivirus.feature#L311)
|
||||
- [apiAntivirus/antivirus.feature:312](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiAntivirus/antivirus.feature#L312)
|
||||
- [apiAntivirus/antivirus.feature:313](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiAntivirus/antivirus.feature#L313)
|
||||
- [apiAntivirus/antivirus.feature:314](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiAntivirus/antivirus.feature#L314)
|
||||
- [apiNotification/deprovisioningNotification.feature:126](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiNotification/deprovisioningNotification.feature#L126)
|
||||
- [apiNotification/deprovisioningNotification.feature:127](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiNotification/deprovisioningNotification.feature#L127)
|
||||
- [apiNotification/notification.feature:282](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiNotification/notification.feature#L282)
|
||||
- [apiNotification/notification.feature:283](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiNotification/notification.feature#L283)
|
||||
- [apiNotification/notification.feature:284](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiNotification/notification.feature#L284)
|
||||
- [apiNotification/notification.feature:285](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiNotification/notification.feature#L285)
|
||||
- [apiNotification/notification.feature:288](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiNotification/notification.feature#L288)
|
||||
- [apiNotification/spaceNotification.feature:434](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiNotification/spaceNotification.feature#L434)
|
||||
- [apiNotification/spaceNotification.feature:435](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiNotification/spaceNotification.feature#L435)
|
||||
- [apiNotification/emailNotification.feature:84](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiNotification/emailNotification.feature#L84)
|
||||
- [apiNotification/emailNotification.feature:117](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiNotification/emailNotification.feature#L117)
|
||||
- [apiNotification/emailNotification.feature:150](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiNotification/emailNotification.feature#L150)
|
||||
- [apiNotification/emailNotification.feature:205](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiNotification/emailNotification.feature#L205)
|
||||
- [apiActivities/activities.feature:2598](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiActivities/activities.feature#L2598)
|
||||
|
||||
|
||||
|
||||
@@ -337,7 +337,6 @@
|
||||
- [coreApiWebdavUploadTUS/uploadFileMtime.feature:39](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/coreApiWebdavUploadTUS/uploadFileMtime.feature#L39)
|
||||
- [coreApiWebdavUploadTUS/uploadFileMtime.feature:51](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/coreApiWebdavUploadTUS/uploadFileMtime.feature#L51)
|
||||
- [coreApiWebdavUploadTUS/uploadFileMtime.feature:65](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/coreApiWebdavUploadTUS/uploadFileMtime.feature#L65)
|
||||
- [coreApiWebdavUploadTUS/uploadFileMtime.feature:79](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/coreApiWebdavUploadTUS/uploadFileMtime.feature#L79)
|
||||
- [coreApiWebdavUploadTUS/uploadFileMtimeShares.feature:29](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/coreApiWebdavUploadTUS/uploadFileMtimeShares.feature#L29)
|
||||
- [coreApiWebdavUploadTUS/uploadFileMtimeShares.feature:48](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/coreApiWebdavUploadTUS/uploadFileMtimeShares.feature#L48)
|
||||
- [coreApiWebdavUploadTUS/uploadFileMtimeShares.feature:69](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/coreApiWebdavUploadTUS/uploadFileMtimeShares.feature#L69)
|
||||
|
||||
@@ -308,7 +308,7 @@ Feature: antivirus
|
||||
| dav-path-version | language | subject | message |
|
||||
| old | es | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Virus: Eicar-Signature |
|
||||
| new | es | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Virus: Eicar-Signature |
|
||||
| spaces | es | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Virus: Eicar-Signature |
|
||||
| spaces | es | Virus encontrado | Virus encontrado en aFileWithVirus.txt. La subida no ha sido posible. Eicar-Signature |
|
||||
| old | de | Virus gefunden | In aFileWithVirus.txt wurde potenziell schädlicher Code gefunden. Das Hochladen wurde abgebrochen. Grund: Eicar-Signature |
|
||||
| new | de | Virus gefunden | In aFileWithVirus.txt wurde potenziell schädlicher Code gefunden. Das Hochladen wurde abgebrochen. Grund: Eicar-Signature |
|
||||
| spaces | de | Virus gefunden | In aFileWithVirus.txt wurde potenziell schädlicher Code gefunden. Das Hochladen wurde abgebrochen. Grund: Eicar-Signature |
|
||||
|
||||
@@ -58,7 +58,7 @@ Feature: create auth-app token
|
||||
],
|
||||
"properties": {
|
||||
"token": {
|
||||
"pattern": "^[0-9A-Fa-f]{8}-[0-9A-Fa-f]{4}-4[0-9A-Fa-f]{3}-[89ABab][0-9A-Fa-f]{3}-[0-9A-Fa-f]{12}$"
|
||||
"pattern": "^\\$argon2id\\$v=19\\$m=65536,t=1,p=16\\$.+$"
|
||||
},
|
||||
"label": {
|
||||
"const": "Generated via API"
|
||||
@@ -75,7 +75,7 @@ Feature: create auth-app token
|
||||
],
|
||||
"properties": {
|
||||
"token": {
|
||||
"pattern": "^[0-9A-Fa-f]{8}-[0-9A-Fa-f]{4}-4[0-9A-Fa-f]{3}-[89ABab][0-9A-Fa-f]{3}-[0-9A-Fa-f]{12}$"
|
||||
"pattern": "^\\$argon2id\\$v=19\\$m=65536,t=1,p=16\\$.+$"
|
||||
},
|
||||
"label": {
|
||||
"const": "Generated via CLI"
|
||||
@@ -92,7 +92,7 @@ Feature: create auth-app token
|
||||
],
|
||||
"properties": {
|
||||
"token": {
|
||||
"pattern": "^[0-9A-Fa-f]{8}-[0-9A-Fa-f]{4}-4[0-9A-Fa-f]{3}-[89ABab][0-9A-Fa-f]{3}-[0-9A-Fa-f]{12}$"
|
||||
"pattern": "^\\$argon2id\\$v=19\\$m=65536,t=1,p=16\\$.+$"
|
||||
},
|
||||
"label": {
|
||||
"const": "Generated via API (Impersonation)"
|
||||
|
||||
@@ -183,7 +183,7 @@ Feature: check file info with different wopi apps
|
||||
"const": true
|
||||
},
|
||||
"UserCanNotWriteRelative": {
|
||||
"const": true
|
||||
"const": false
|
||||
},
|
||||
"EnableOwnerTermination": {
|
||||
"const": true
|
||||
@@ -581,7 +581,7 @@ Feature: check file info with different wopi apps
|
||||
"const": <user-can-write>
|
||||
},
|
||||
"UserCanNotWriteRelative": {
|
||||
"const": true
|
||||
"const": false
|
||||
},
|
||||
"EnableOwnerTermination": {
|
||||
"const": true
|
||||
@@ -691,7 +691,7 @@ Feature: check file info with different wopi apps
|
||||
"const": true
|
||||
},
|
||||
"UserCanNotWriteRelative": {
|
||||
"const": true
|
||||
"const": false
|
||||
},
|
||||
"EnableOwnerTermination": {
|
||||
"const": true
|
||||
@@ -1077,7 +1077,7 @@ Feature: check file info with different wopi apps
|
||||
"const": true
|
||||
},
|
||||
"UserCanNotWriteRelative": {
|
||||
"const": true
|
||||
"const": false
|
||||
},
|
||||
"EnableOwnerTermination": {
|
||||
"const": true
|
||||
@@ -1424,7 +1424,7 @@ Feature: check file info with different wopi apps
|
||||
"const": true
|
||||
},
|
||||
"UserCanNotWriteRelative": {
|
||||
"const": true
|
||||
"const": false
|
||||
},
|
||||
"EnableOwnerTermination": {
|
||||
"const": true
|
||||
@@ -1810,7 +1810,7 @@ Feature: check file info with different wopi apps
|
||||
"const": <user-can-write>
|
||||
},
|
||||
"UserCanNotWriteRelative": {
|
||||
"const": true
|
||||
"const": false
|
||||
},
|
||||
"EnableOwnerTermination": {
|
||||
"const": true
|
||||
|
||||
102
vendor/github.com/go-playground/validator/v10/.golangci.yaml
generated
vendored
102
vendor/github.com/go-playground/validator/v10/.golangci.yaml
generated
vendored
@@ -1,102 +0,0 @@
|
||||
version: "2"
|
||||
linters:
|
||||
default: all
|
||||
disable:
|
||||
- asasalint
|
||||
- asciicheck
|
||||
- bidichk
|
||||
- bodyclose
|
||||
- canonicalheader
|
||||
- containedctx
|
||||
- contextcheck
|
||||
- copyloopvar
|
||||
- cyclop
|
||||
- decorder
|
||||
- depguard
|
||||
- dogsled
|
||||
- dupl
|
||||
- dupword
|
||||
- durationcheck
|
||||
- err113
|
||||
- errcheck
|
||||
- errchkjson
|
||||
- errname
|
||||
- errorlint
|
||||
- exhaustive
|
||||
- exhaustruct
|
||||
- exptostd
|
||||
- fatcontext
|
||||
- forbidigo
|
||||
- forcetypeassert
|
||||
- funlen
|
||||
- ginkgolinter
|
||||
- gocheckcompilerdirectives
|
||||
- gochecknoglobals
|
||||
- gochecknoinits
|
||||
- gochecksumtype
|
||||
- gocognit
|
||||
- goconst
|
||||
- gocritic
|
||||
- gocyclo
|
||||
- godot
|
||||
- godox
|
||||
- goheader
|
||||
- gomoddirectives
|
||||
- gomodguard
|
||||
- goprintffuncname
|
||||
- gosec
|
||||
- gosmopolitan
|
||||
- govet
|
||||
- grouper
|
||||
- iface
|
||||
- importas
|
||||
- inamedparam
|
||||
- ineffassign
|
||||
- interfacebloat
|
||||
- intrange
|
||||
- ireturn
|
||||
- lll
|
||||
- loggercheck
|
||||
- maintidx
|
||||
- makezero
|
||||
- mirror
|
||||
- misspell
|
||||
- mnd
|
||||
- musttag
|
||||
- nakedret
|
||||
- nestif
|
||||
- nilerr
|
||||
- nilnesserr
|
||||
- nilnil
|
||||
- nlreturn
|
||||
- noctx
|
||||
- nolintlint
|
||||
- nonamedreturns
|
||||
- nosprintfhostport
|
||||
- paralleltest
|
||||
- perfsprint
|
||||
- prealloc
|
||||
- predeclared
|
||||
- promlinter
|
||||
- protogetter
|
||||
- reassign
|
||||
- recvcheck
|
||||
- revive
|
||||
- rowserrcheck
|
||||
- sloglint
|
||||
- spancheck
|
||||
- sqlclosecheck
|
||||
- staticcheck
|
||||
- tagalign
|
||||
- tagliatelle
|
||||
- testableexamples
|
||||
- testifylint
|
||||
- testpackage
|
||||
- thelper
|
||||
- tparallel
|
||||
- unparam
|
||||
- varnamelen
|
||||
- whitespace
|
||||
- wrapcheck
|
||||
- wsl
|
||||
- zerologlint
|
||||
2
vendor/github.com/go-playground/validator/v10/Makefile
generated
vendored
2
vendor/github.com/go-playground/validator/v10/Makefile
generated
vendored
@@ -3,7 +3,7 @@ GOCMD=go
|
||||
linters-install:
|
||||
@golangci-lint --version >/dev/null 2>&1 || { \
|
||||
echo "installing linting tools..."; \
|
||||
curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v2.0.2; \
|
||||
curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v1.41.1; \
|
||||
}
|
||||
|
||||
lint: linters-install
|
||||
|
||||
4
vendor/github.com/go-playground/validator/v10/README.md
generated
vendored
4
vendor/github.com/go-playground/validator/v10/README.md
generated
vendored
@@ -1,6 +1,7 @@
|
||||
Package validator
|
||||
=================
|
||||
<img align="right" src="logo.png">
|
||||
<img align="right" src="logo.png">[](https://gitter.im/go-playground/validator?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge)
|
||||

|
||||
[](https://github.com/go-playground/validator/actions)
|
||||
[](https://coveralls.io/github/go-playground/validator?branch=master)
|
||||
[](https://goreportcard.com/report/github.com/go-playground/validator)
|
||||
@@ -172,7 +173,6 @@ validate := validator.New(validator.WithRequiredStructEnabled())
|
||||
| spicedb | SpiceDb ObjectID/Permission/Type |
|
||||
| datetime | Datetime |
|
||||
| e164 | e164 formatted phone number |
|
||||
| ein | U.S. Employeer Identification Number |
|
||||
| email | E-mail String
|
||||
| eth_addr | Ethereum Address |
|
||||
| hexadecimal | Hexadecimal String |
|
||||
|
||||
35
vendor/github.com/go-playground/validator/v10/baked_in.go
generated
vendored
35
vendor/github.com/go-playground/validator/v10/baked_in.go
generated
vendored
@@ -9,7 +9,6 @@ import (
|
||||
"fmt"
|
||||
"io/fs"
|
||||
"net"
|
||||
"net/mail"
|
||||
"net/url"
|
||||
"os"
|
||||
"reflect"
|
||||
@@ -243,7 +242,6 @@ var (
|
||||
"mongodb_connection_string": isMongoDBConnectionString,
|
||||
"cron": isCron,
|
||||
"spicedb": isSpiceDB,
|
||||
"ein": isEIN,
|
||||
}
|
||||
)
|
||||
|
||||
@@ -260,7 +258,7 @@ func parseOneOfParam2(s string) []string {
|
||||
oneofValsCacheRWLock.Lock()
|
||||
vals = splitParamsRegex().FindAllString(s, -1)
|
||||
for i := 0; i < len(vals); i++ {
|
||||
vals[i] = strings.ReplaceAll(vals[i], "'", "")
|
||||
vals[i] = strings.Replace(vals[i], "'", "", -1)
|
||||
}
|
||||
oneofValsCache[s] = vals
|
||||
oneofValsCacheRWLock.Unlock()
|
||||
@@ -1378,6 +1376,7 @@ func isEqIgnoreCase(fl FieldLevel) bool {
|
||||
param := fl.Param()
|
||||
|
||||
switch field.Kind() {
|
||||
|
||||
case reflect.String:
|
||||
return strings.EqualFold(field.String(), param)
|
||||
}
|
||||
@@ -1607,6 +1606,7 @@ func isImage(fl FieldLevel) bool {
|
||||
case reflect.String:
|
||||
filePath := field.String()
|
||||
fileInfo, err := os.Stat(filePath)
|
||||
|
||||
if err != nil {
|
||||
return false
|
||||
}
|
||||
@@ -1619,9 +1619,7 @@ func isImage(fl FieldLevel) bool {
|
||||
if err != nil {
|
||||
return false
|
||||
}
|
||||
defer func() {
|
||||
_ = file.Close()
|
||||
}()
|
||||
defer file.Close()
|
||||
|
||||
mime, err := mimetype.DetectReader(file)
|
||||
if err != nil {
|
||||
@@ -1637,6 +1635,7 @@ func isImage(fl FieldLevel) bool {
|
||||
|
||||
// isFilePath is the validation function for validating if the current field's value is a valid file path.
|
||||
func isFilePath(fl FieldLevel) bool {
|
||||
|
||||
var exists bool
|
||||
var err error
|
||||
|
||||
@@ -1696,10 +1695,6 @@ func isE164(fl FieldLevel) bool {
|
||||
|
||||
// isEmail is the validation function for validating if the current field's value is a valid email address.
|
||||
func isEmail(fl FieldLevel) bool {
|
||||
_, err := mail.ParseAddress(fl.Field().String())
|
||||
if err != nil {
|
||||
return false
|
||||
}
|
||||
return emailRegex().MatchString(fl.Field().String())
|
||||
}
|
||||
|
||||
@@ -2232,6 +2227,7 @@ func isGt(fl FieldLevel) bool {
|
||||
case reflect.Struct:
|
||||
|
||||
if field.Type().ConvertibleTo(timeType) {
|
||||
|
||||
return field.Convert(timeType).Interface().(time.Time).After(time.Now().UTC())
|
||||
}
|
||||
}
|
||||
@@ -2468,6 +2464,7 @@ func isLt(fl FieldLevel) bool {
|
||||
case reflect.Struct:
|
||||
|
||||
if field.Type().ConvertibleTo(timeType) {
|
||||
|
||||
return field.Convert(timeType).Interface().(time.Time).Before(time.Now().UTC())
|
||||
}
|
||||
}
|
||||
@@ -2647,6 +2644,7 @@ func isDir(fl FieldLevel) bool {
|
||||
|
||||
// isDirPath is the validation function for validating if the current field's value is a valid directory.
|
||||
func isDirPath(fl FieldLevel) bool {
|
||||
|
||||
var exists bool
|
||||
var err error
|
||||
|
||||
@@ -2959,12 +2957,6 @@ func isCveFormat(fl FieldLevel) bool {
|
||||
// a valid dns RFC 1035 label, defined in RFC 1035.
|
||||
func isDnsRFC1035LabelFormat(fl FieldLevel) bool {
|
||||
val := fl.Field().String()
|
||||
|
||||
size := len(val)
|
||||
if size > 63 {
|
||||
return false
|
||||
}
|
||||
|
||||
return dnsRegexRFC1035Label().MatchString(val)
|
||||
}
|
||||
|
||||
@@ -3068,14 +3060,3 @@ func isCron(fl FieldLevel) bool {
|
||||
cronString := fl.Field().String()
|
||||
return cronRegex().MatchString(cronString)
|
||||
}
|
||||
|
||||
// isEIN is the validation function for validating if the current field's value is a valid U.S. Employer Identification Number (EIN)
|
||||
func isEIN(fl FieldLevel) bool {
|
||||
field := fl.Field()
|
||||
|
||||
if field.Len() != 10 {
|
||||
return false
|
||||
}
|
||||
|
||||
return einRegex().MatchString(field.String())
|
||||
}
|
||||
|
||||
2
vendor/github.com/go-playground/validator/v10/cache.go
generated
vendored
2
vendor/github.com/go-playground/validator/v10/cache.go
generated
vendored
@@ -309,7 +309,7 @@ func (v *Validate) parseFieldTagsRecursive(tag string, fieldName string, alias s
|
||||
}
|
||||
|
||||
if len(vals) > 1 {
|
||||
current.param = strings.ReplaceAll(strings.ReplaceAll(vals[1], utf8HexComma, ","), utf8Pipe, "|")
|
||||
current.param = strings.Replace(strings.Replace(vals[1], utf8HexComma, ",", -1), utf8Pipe, "|", -1)
|
||||
}
|
||||
}
|
||||
current.isBlockEnd = true
|
||||
|
||||
8
vendor/github.com/go-playground/validator/v10/doc.go
generated
vendored
8
vendor/github.com/go-playground/validator/v10/doc.go
generated
vendored
@@ -959,7 +959,7 @@ Although an empty string is a valid base64 URL safe value, this will report
|
||||
an empty string as an error, if you wish to accept an empty string as valid
|
||||
you can use this with the omitempty tag.
|
||||
|
||||
Usage: base64rawurl
|
||||
Usage: base64url
|
||||
|
||||
# Bitcoin Address
|
||||
|
||||
@@ -1134,12 +1134,6 @@ This validates that a string value contains a valid longitude.
|
||||
|
||||
Usage: longitude
|
||||
|
||||
# Employeer Identification Number EIN
|
||||
|
||||
This validates that a string value contains a valid U.S. Employer Identification Number.
|
||||
|
||||
Usage: ein
|
||||
|
||||
# Social Security Number SSN
|
||||
|
||||
This validates that a string value contains a valid U.S. Social Security Number.
|
||||
|
||||
4
vendor/github.com/go-playground/validator/v10/regexes.go
generated
vendored
4
vendor/github.com/go-playground/validator/v10/regexes.go
generated
vendored
@@ -69,7 +69,7 @@ const (
|
||||
splitParamsRegexString = `'[^']*'|\S+`
|
||||
bicRegexString = `^[A-Za-z]{6}[A-Za-z0-9]{2}([A-Za-z0-9]{3})?$`
|
||||
semverRegexString = `^(0|[1-9]\d*)\.(0|[1-9]\d*)\.(0|[1-9]\d*)(?:-((?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*)(?:\.(?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*))*))?(?:\+([0-9a-zA-Z-]+(?:\.[0-9a-zA-Z-]+)*))?$` // numbered capture groups https://semver.org/
|
||||
dnsRegexStringRFC1035Label = "^[a-z]([-a-z0-9]*[a-z0-9])?$"
|
||||
dnsRegexStringRFC1035Label = "^[a-z]([-a-z0-9]*[a-z0-9]){0,62}$"
|
||||
cveRegexString = `^CVE-(1999|2\d{3})-(0[^0]\d{2}|0\d[^0]\d{1}|0\d{2}[^0]|[1-9]{1}\d{3,})$` // CVE Format Id https://cve.mitre.org/cve/identifiers/syntaxchange.html
|
||||
mongodbIdRegexString = "^[a-f\\d]{24}$"
|
||||
mongodbConnStringRegexString = "^mongodb(\\+srv)?:\\/\\/(([a-zA-Z\\d]+):([a-zA-Z\\d$:\\/?#\\[\\]@]+)@)?(([a-z\\d.-]+)(:[\\d]+)?)((,(([a-z\\d.-]+)(:(\\d+))?))*)?(\\/[a-zA-Z-_]{1,64})?(\\?(([a-zA-Z]+)=([a-zA-Z\\d]+))(&(([a-zA-Z\\d]+)=([a-zA-Z\\d]+))?)*)?$"
|
||||
@@ -77,7 +77,6 @@ const (
|
||||
spicedbIDRegexString = `^(([a-zA-Z0-9/_|\-=+]{1,})|\*)$`
|
||||
spicedbPermissionRegexString = "^([a-z][a-z0-9_]{1,62}[a-z0-9])?$"
|
||||
spicedbTypeRegexString = "^([a-z][a-z0-9_]{1,61}[a-z0-9]/)?[a-z][a-z0-9_]{1,62}[a-z0-9]$"
|
||||
einRegexString = "^(\\d{2}-\\d{7})$"
|
||||
)
|
||||
|
||||
func lazyRegexCompile(str string) func() *regexp.Regexp {
|
||||
@@ -161,5 +160,4 @@ var (
|
||||
spicedbIDRegex = lazyRegexCompile(spicedbIDRegexString)
|
||||
spicedbPermissionRegex = lazyRegexCompile(spicedbPermissionRegexString)
|
||||
spicedbTypeRegex = lazyRegexCompile(spicedbTypeRegexString)
|
||||
einRegex = lazyRegexCompile(einRegexString)
|
||||
)
|
||||
|
||||
6
vendor/github.com/go-playground/validator/v10/struct_level.go
generated
vendored
6
vendor/github.com/go-playground/validator/v10/struct_level.go
generated
vendored
@@ -46,9 +46,9 @@ type StructLevel interface {
|
||||
//
|
||||
// NOTES:
|
||||
//
|
||||
// fieldName and structFieldName get appended to the existing
|
||||
// namespace that validator is on. e.g. pass 'FirstName' or
|
||||
// 'Names[0]' depending on the nesting
|
||||
// fieldName and altName get appended to the existing namespace that
|
||||
// validator is on. e.g. pass 'FirstName' or 'Names[0]' depending
|
||||
// on the nesting
|
||||
//
|
||||
// tag can be an existing validation tag or just something you make up
|
||||
// and process on the flip side it's up to you.
|
||||
|
||||
70
vendor/github.com/go-playground/validator/v10/translations/en/en.go
generated
vendored
70
vendor/github.com/go-playground/validator/v10/translations/en/en.go
generated
vendored
@@ -217,18 +217,17 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
customTransFunc: func(ut ut.Translator, fe validator.FieldError) string {
|
||||
var err error
|
||||
var t string
|
||||
var f64 float64
|
||||
|
||||
var digits uint64
|
||||
var kind reflect.Kind
|
||||
|
||||
fn := func() (err error) {
|
||||
if idx := strings.Index(fe.Param(), "."); idx != -1 {
|
||||
digits = uint64(len(fe.Param()[idx+1:]))
|
||||
}
|
||||
if idx := strings.Index(fe.Param(), "."); idx != -1 {
|
||||
digits = uint64(len(fe.Param()[idx+1:]))
|
||||
}
|
||||
|
||||
f64, err = strconv.ParseFloat(fe.Param(), 64)
|
||||
|
||||
return
|
||||
f64, err := strconv.ParseFloat(fe.Param(), 64)
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
kind = fe.Kind()
|
||||
@@ -241,11 +240,6 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
|
||||
var c string
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
c, err = ut.C("min-string-character", f64, digits, ut.FmtNumber(f64, digits))
|
||||
if err != nil {
|
||||
goto END
|
||||
@@ -256,11 +250,6 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
case reflect.Slice, reflect.Map, reflect.Array:
|
||||
var c string
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
c, err = ut.C("min-items-item", f64, digits, ut.FmtNumber(f64, digits))
|
||||
if err != nil {
|
||||
goto END
|
||||
@@ -269,16 +258,6 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
t, err = ut.T("min-items", fe.Field(), c)
|
||||
|
||||
default:
|
||||
if fe.Type() == reflect.TypeOf(time.Duration(0)) {
|
||||
t, err = ut.T("min-number", fe.Field(), fe.Param())
|
||||
goto END
|
||||
}
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
t, err = ut.T("min-number", fe.Field(), ut.FmtNumber(f64, digits))
|
||||
}
|
||||
|
||||
@@ -326,18 +305,17 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
customTransFunc: func(ut ut.Translator, fe validator.FieldError) string {
|
||||
var err error
|
||||
var t string
|
||||
var f64 float64
|
||||
|
||||
var digits uint64
|
||||
var kind reflect.Kind
|
||||
|
||||
fn := func() (err error) {
|
||||
if idx := strings.Index(fe.Param(), "."); idx != -1 {
|
||||
digits = uint64(len(fe.Param()[idx+1:]))
|
||||
}
|
||||
if idx := strings.Index(fe.Param(), "."); idx != -1 {
|
||||
digits = uint64(len(fe.Param()[idx+1:]))
|
||||
}
|
||||
|
||||
f64, err = strconv.ParseFloat(fe.Param(), 64)
|
||||
|
||||
return
|
||||
f64, err := strconv.ParseFloat(fe.Param(), 64)
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
kind = fe.Kind()
|
||||
@@ -350,11 +328,6 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
|
||||
var c string
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
c, err = ut.C("max-string-character", f64, digits, ut.FmtNumber(f64, digits))
|
||||
if err != nil {
|
||||
goto END
|
||||
@@ -365,11 +338,6 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
case reflect.Slice, reflect.Map, reflect.Array:
|
||||
var c string
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
c, err = ut.C("max-items-item", f64, digits, ut.FmtNumber(f64, digits))
|
||||
if err != nil {
|
||||
goto END
|
||||
@@ -378,16 +346,6 @@ func RegisterDefaultTranslations(v *validator.Validate, trans ut.Translator) (er
|
||||
t, err = ut.T("max-items", fe.Field(), c)
|
||||
|
||||
default:
|
||||
if fe.Type() == reflect.TypeOf(time.Duration(0)) {
|
||||
t, err = ut.T("max-number", fe.Field(), fe.Param())
|
||||
goto END
|
||||
}
|
||||
|
||||
err = fn()
|
||||
if err != nil {
|
||||
goto END
|
||||
}
|
||||
|
||||
t, err = ut.T("max-number", fe.Field(), ut.FmtNumber(f64, digits))
|
||||
}
|
||||
|
||||
|
||||
23
vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml
generated
vendored
23
vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml
generated
vendored
@@ -1,4 +1,5 @@
|
||||
version: 2
|
||||
# This is an example goreleaser.yaml file with some sane defaults.
|
||||
# Make sure to check the documentation at http://goreleaser.com
|
||||
|
||||
builds:
|
||||
-
|
||||
@@ -26,7 +27,16 @@ builds:
|
||||
archives:
|
||||
-
|
||||
id: cpuid
|
||||
name_template: "cpuid-{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
|
||||
name_template: "cpuid-{{ .Os }}_{{ .Arch }}_{{ .Version }}"
|
||||
replacements:
|
||||
aix: AIX
|
||||
darwin: OSX
|
||||
linux: Linux
|
||||
windows: Windows
|
||||
386: i386
|
||||
amd64: x86_64
|
||||
freebsd: FreeBSD
|
||||
netbsd: NetBSD
|
||||
format_overrides:
|
||||
- goos: windows
|
||||
format: zip
|
||||
@@ -34,6 +44,8 @@ archives:
|
||||
- LICENSE
|
||||
checksum:
|
||||
name_template: 'checksums.txt'
|
||||
snapshot:
|
||||
name_template: "{{ .Tag }}-next"
|
||||
changelog:
|
||||
sort: asc
|
||||
filters:
|
||||
@@ -46,7 +58,7 @@ changelog:
|
||||
|
||||
nfpms:
|
||||
-
|
||||
file_name_template: "cpuid_package_{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
|
||||
file_name_template: "cpuid_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}"
|
||||
vendor: Klaus Post
|
||||
homepage: https://github.com/klauspost/cpuid
|
||||
maintainer: Klaus Post <klauspost@gmail.com>
|
||||
@@ -55,3 +67,8 @@ nfpms:
|
||||
formats:
|
||||
- deb
|
||||
- rpm
|
||||
replacements:
|
||||
darwin: Darwin
|
||||
linux: Linux
|
||||
freebsd: FreeBSD
|
||||
amd64: x86_64
|
||||
|
||||
6
vendor/github.com/klauspost/cpuid/v2/README.md
generated
vendored
6
vendor/github.com/klauspost/cpuid/v2/README.md
generated
vendored
@@ -282,9 +282,7 @@ Exit Code 1
|
||||
| AMXINT8 | Tile computational operations on 8-bit integers |
|
||||
| AMXFP16 | Tile computational operations on FP16 numbers |
|
||||
| AMXFP8 | Tile computational operations on FP8 numbers |
|
||||
| AMXCOMPLEX | Tile computational operations on complex numbers |
|
||||
| AMXTILE | Tile architecture |
|
||||
| AMXTF32 | Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile |
|
||||
| APX_F | Intel APX |
|
||||
| AVX | AVX functions |
|
||||
| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported |
|
||||
@@ -482,16 +480,12 @@ Exit Code 1
|
||||
| DCPOP | Data cache clean to Point of Persistence (DC CVAP) |
|
||||
| EVTSTRM | Generic timer |
|
||||
| FCMA | Floatin point complex number addition and multiplication |
|
||||
| FHM | FMLAL and FMLSL instructions |
|
||||
| FP | Single-precision and double-precision floating point |
|
||||
| FPHP | Half-precision floating point |
|
||||
| GPA | Generic Pointer Authentication |
|
||||
| JSCVT | Javascript-style double->int convert (FJCVTZS) |
|
||||
| LRCPC | Weaker release consistency (LDAPR, etc) |
|
||||
| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) |
|
||||
| RNDR | Random Number instructions |
|
||||
| TLB | Outer Shareable and TLB range maintenance instructions |
|
||||
| TS | Flag manipulation instructions |
|
||||
| SHA1 | SHA-1 instructions (SHA1C, etc) |
|
||||
| SHA2 | SHA-2 instructions (SHA256H, etc) |
|
||||
| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) |
|
||||
|
||||
10
vendor/github.com/klauspost/cpuid/v2/cpuid.go
generated
vendored
10
vendor/github.com/klauspost/cpuid/v2/cpuid.go
generated
vendored
@@ -83,8 +83,6 @@ const (
|
||||
AMXINT8 // Tile computational operations on 8-bit integers
|
||||
AMXFP8 // Tile computational operations on FP8 numbers
|
||||
AMXTILE // Tile architecture
|
||||
AMXTF32 // Tile architecture
|
||||
AMXCOMPLEX // Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile
|
||||
APX_F // Intel APX
|
||||
AVX // AVX functions
|
||||
AVX10 // If set the Intel AVX10 Converged Vector ISA is supported
|
||||
@@ -284,16 +282,12 @@ const (
|
||||
DCPOP // Data cache clean to Point of Persistence (DC CVAP)
|
||||
EVTSTRM // Generic timer
|
||||
FCMA // Floatin point complex number addition and multiplication
|
||||
FHM // FMLAL and FMLSL instructions
|
||||
FP // Single-precision and double-precision floating point
|
||||
FPHP // Half-precision floating point
|
||||
GPA // Generic Pointer Authentication
|
||||
JSCVT // Javascript-style double->int convert (FJCVTZS)
|
||||
LRCPC // Weaker release consistency (LDAPR, etc)
|
||||
PMULL // Polynomial Multiply instructions (PMULL/PMULL2)
|
||||
RNDR // Random Number instructions
|
||||
TLB // Outer Shareable and TLB range maintenance instructions
|
||||
TS // Flag manipulation instructions
|
||||
SHA1 // SHA-1 instructions (SHA1C, etc)
|
||||
SHA2 // SHA-2 instructions (SHA256H, etc)
|
||||
SHA3 // SHA-3 instructions (EOR3, RAXI, XAR, BCAX)
|
||||
@@ -538,7 +532,7 @@ func (c CPUInfo) Ia32TscAux() uint32 {
|
||||
return ecx
|
||||
}
|
||||
|
||||
// SveLengths returns arm SVE vector and predicate lengths in bits.
|
||||
// SveLengths returns arm SVE vector and predicate lengths.
|
||||
// Will return 0, 0 if SVE is not enabled or otherwise unable to detect.
|
||||
func (c CPUInfo) SveLengths() (vl, pl uint64) {
|
||||
if !c.Has(SVE) {
|
||||
@@ -1290,8 +1284,6 @@ func support() flagSet {
|
||||
// CPUID.(EAX=7, ECX=1).EDX
|
||||
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
|
||||
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
|
||||
fs.setIf(edx1&(1<<7) != 0, AMXTF32)
|
||||
fs.setIf(edx1&(1<<8) != 0, AMXCOMPLEX)
|
||||
fs.setIf(edx1&(1<<10) != 0, AVXVNNIINT16)
|
||||
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
|
||||
fs.setIf(edx1&(1<<19) != 0, AVX10)
|
||||
|
||||
14
vendor/github.com/klauspost/cpuid/v2/detect_arm64.go
generated
vendored
14
vendor/github.com/klauspost/cpuid/v2/detect_arm64.go
generated
vendored
@@ -157,10 +157,6 @@ func addInfo(c *CPUInfo, safe bool) {
|
||||
// x--------------------------------------------------x
|
||||
// | Name | bits | visible |
|
||||
// |--------------------------------------------------|
|
||||
// | RNDR | [63-60] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | TLB | [59-56] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | TS | [55-52] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | FHM | [51-48] | y |
|
||||
@@ -186,10 +182,12 @@ func addInfo(c *CPUInfo, safe bool) {
|
||||
// | AES | [7-4] | y |
|
||||
// x--------------------------------------------------x
|
||||
|
||||
f.setIf(instAttrReg0&(0xf<<60) != 0, RNDR)
|
||||
f.setIf(instAttrReg0&(0xf<<56) != 0, TLB)
|
||||
f.setIf(instAttrReg0&(0xf<<52) != 0, TS)
|
||||
f.setIf(instAttrReg0&(0xf<<48) != 0, FHM)
|
||||
// if instAttrReg0&(0xf<<52) != 0 {
|
||||
// fmt.Println("TS")
|
||||
// }
|
||||
// if instAttrReg0&(0xf<<48) != 0 {
|
||||
// fmt.Println("FHM")
|
||||
// }
|
||||
f.setIf(instAttrReg0&(0xf<<44) != 0, ASIMDDP)
|
||||
f.setIf(instAttrReg0&(0xf<<40) != 0, SM4)
|
||||
f.setIf(instAttrReg0&(0xf<<36) != 0, SM3)
|
||||
|
||||
432
vendor/github.com/klauspost/cpuid/v2/featureid_string.go
generated
vendored
432
vendor/github.com/klauspost/cpuid/v2/featureid_string.go
generated
vendored
@@ -17,229 +17,223 @@ func _() {
|
||||
_ = x[AMXINT8-7]
|
||||
_ = x[AMXFP8-8]
|
||||
_ = x[AMXTILE-9]
|
||||
_ = x[AMXTF32-10]
|
||||
_ = x[AMXCOMPLEX-11]
|
||||
_ = x[APX_F-12]
|
||||
_ = x[AVX-13]
|
||||
_ = x[AVX10-14]
|
||||
_ = x[AVX10_128-15]
|
||||
_ = x[AVX10_256-16]
|
||||
_ = x[AVX10_512-17]
|
||||
_ = x[AVX2-18]
|
||||
_ = x[AVX512BF16-19]
|
||||
_ = x[AVX512BITALG-20]
|
||||
_ = x[AVX512BW-21]
|
||||
_ = x[AVX512CD-22]
|
||||
_ = x[AVX512DQ-23]
|
||||
_ = x[AVX512ER-24]
|
||||
_ = x[AVX512F-25]
|
||||
_ = x[AVX512FP16-26]
|
||||
_ = x[AVX512IFMA-27]
|
||||
_ = x[AVX512PF-28]
|
||||
_ = x[AVX512VBMI-29]
|
||||
_ = x[AVX512VBMI2-30]
|
||||
_ = x[AVX512VL-31]
|
||||
_ = x[AVX512VNNI-32]
|
||||
_ = x[AVX512VP2INTERSECT-33]
|
||||
_ = x[AVX512VPOPCNTDQ-34]
|
||||
_ = x[AVXIFMA-35]
|
||||
_ = x[AVXNECONVERT-36]
|
||||
_ = x[AVXSLOW-37]
|
||||
_ = x[AVXVNNI-38]
|
||||
_ = x[AVXVNNIINT8-39]
|
||||
_ = x[AVXVNNIINT16-40]
|
||||
_ = x[BHI_CTRL-41]
|
||||
_ = x[BMI1-42]
|
||||
_ = x[BMI2-43]
|
||||
_ = x[CETIBT-44]
|
||||
_ = x[CETSS-45]
|
||||
_ = x[CLDEMOTE-46]
|
||||
_ = x[CLMUL-47]
|
||||
_ = x[CLZERO-48]
|
||||
_ = x[CMOV-49]
|
||||
_ = x[CMPCCXADD-50]
|
||||
_ = x[CMPSB_SCADBS_SHORT-51]
|
||||
_ = x[CMPXCHG8-52]
|
||||
_ = x[CPBOOST-53]
|
||||
_ = x[CPPC-54]
|
||||
_ = x[CX16-55]
|
||||
_ = x[EFER_LMSLE_UNS-56]
|
||||
_ = x[ENQCMD-57]
|
||||
_ = x[ERMS-58]
|
||||
_ = x[F16C-59]
|
||||
_ = x[FLUSH_L1D-60]
|
||||
_ = x[FMA3-61]
|
||||
_ = x[FMA4-62]
|
||||
_ = x[FP128-63]
|
||||
_ = x[FP256-64]
|
||||
_ = x[FSRM-65]
|
||||
_ = x[FXSR-66]
|
||||
_ = x[FXSROPT-67]
|
||||
_ = x[GFNI-68]
|
||||
_ = x[HLE-69]
|
||||
_ = x[HRESET-70]
|
||||
_ = x[HTT-71]
|
||||
_ = x[HWA-72]
|
||||
_ = x[HYBRID_CPU-73]
|
||||
_ = x[HYPERVISOR-74]
|
||||
_ = x[IA32_ARCH_CAP-75]
|
||||
_ = x[IA32_CORE_CAP-76]
|
||||
_ = x[IBPB-77]
|
||||
_ = x[IBPB_BRTYPE-78]
|
||||
_ = x[IBRS-79]
|
||||
_ = x[IBRS_PREFERRED-80]
|
||||
_ = x[IBRS_PROVIDES_SMP-81]
|
||||
_ = x[IBS-82]
|
||||
_ = x[IBSBRNTRGT-83]
|
||||
_ = x[IBSFETCHSAM-84]
|
||||
_ = x[IBSFFV-85]
|
||||
_ = x[IBSOPCNT-86]
|
||||
_ = x[IBSOPCNTEXT-87]
|
||||
_ = x[IBSOPSAM-88]
|
||||
_ = x[IBSRDWROPCNT-89]
|
||||
_ = x[IBSRIPINVALIDCHK-90]
|
||||
_ = x[IBS_FETCH_CTLX-91]
|
||||
_ = x[IBS_OPDATA4-92]
|
||||
_ = x[IBS_OPFUSE-93]
|
||||
_ = x[IBS_PREVENTHOST-94]
|
||||
_ = x[IBS_ZEN4-95]
|
||||
_ = x[IDPRED_CTRL-96]
|
||||
_ = x[INT_WBINVD-97]
|
||||
_ = x[INVLPGB-98]
|
||||
_ = x[KEYLOCKER-99]
|
||||
_ = x[KEYLOCKERW-100]
|
||||
_ = x[LAHF-101]
|
||||
_ = x[LAM-102]
|
||||
_ = x[LBRVIRT-103]
|
||||
_ = x[LZCNT-104]
|
||||
_ = x[MCAOVERFLOW-105]
|
||||
_ = x[MCDT_NO-106]
|
||||
_ = x[MCOMMIT-107]
|
||||
_ = x[MD_CLEAR-108]
|
||||
_ = x[MMX-109]
|
||||
_ = x[MMXEXT-110]
|
||||
_ = x[MOVBE-111]
|
||||
_ = x[MOVDIR64B-112]
|
||||
_ = x[MOVDIRI-113]
|
||||
_ = x[MOVSB_ZL-114]
|
||||
_ = x[MOVU-115]
|
||||
_ = x[MPX-116]
|
||||
_ = x[MSRIRC-117]
|
||||
_ = x[MSRLIST-118]
|
||||
_ = x[MSR_PAGEFLUSH-119]
|
||||
_ = x[NRIPS-120]
|
||||
_ = x[NX-121]
|
||||
_ = x[OSXSAVE-122]
|
||||
_ = x[PCONFIG-123]
|
||||
_ = x[POPCNT-124]
|
||||
_ = x[PPIN-125]
|
||||
_ = x[PREFETCHI-126]
|
||||
_ = x[PSFD-127]
|
||||
_ = x[RDPRU-128]
|
||||
_ = x[RDRAND-129]
|
||||
_ = x[RDSEED-130]
|
||||
_ = x[RDTSCP-131]
|
||||
_ = x[RRSBA_CTRL-132]
|
||||
_ = x[RTM-133]
|
||||
_ = x[RTM_ALWAYS_ABORT-134]
|
||||
_ = x[SBPB-135]
|
||||
_ = x[SERIALIZE-136]
|
||||
_ = x[SEV-137]
|
||||
_ = x[SEV_64BIT-138]
|
||||
_ = x[SEV_ALTERNATIVE-139]
|
||||
_ = x[SEV_DEBUGSWAP-140]
|
||||
_ = x[SEV_ES-141]
|
||||
_ = x[SEV_RESTRICTED-142]
|
||||
_ = x[SEV_SNP-143]
|
||||
_ = x[SGX-144]
|
||||
_ = x[SGXLC-145]
|
||||
_ = x[SHA-146]
|
||||
_ = x[SME-147]
|
||||
_ = x[SME_COHERENT-148]
|
||||
_ = x[SPEC_CTRL_SSBD-149]
|
||||
_ = x[SRBDS_CTRL-150]
|
||||
_ = x[SRSO_MSR_FIX-151]
|
||||
_ = x[SRSO_NO-152]
|
||||
_ = x[SRSO_USER_KERNEL_NO-153]
|
||||
_ = x[SSE-154]
|
||||
_ = x[SSE2-155]
|
||||
_ = x[SSE3-156]
|
||||
_ = x[SSE4-157]
|
||||
_ = x[SSE42-158]
|
||||
_ = x[SSE4A-159]
|
||||
_ = x[SSSE3-160]
|
||||
_ = x[STIBP-161]
|
||||
_ = x[STIBP_ALWAYSON-162]
|
||||
_ = x[STOSB_SHORT-163]
|
||||
_ = x[SUCCOR-164]
|
||||
_ = x[SVM-165]
|
||||
_ = x[SVMDA-166]
|
||||
_ = x[SVMFBASID-167]
|
||||
_ = x[SVML-168]
|
||||
_ = x[SVMNP-169]
|
||||
_ = x[SVMPF-170]
|
||||
_ = x[SVMPFT-171]
|
||||
_ = x[SYSCALL-172]
|
||||
_ = x[SYSEE-173]
|
||||
_ = x[TBM-174]
|
||||
_ = x[TDX_GUEST-175]
|
||||
_ = x[TLB_FLUSH_NESTED-176]
|
||||
_ = x[TME-177]
|
||||
_ = x[TOPEXT-178]
|
||||
_ = x[TSCRATEMSR-179]
|
||||
_ = x[TSXLDTRK-180]
|
||||
_ = x[VAES-181]
|
||||
_ = x[VMCBCLEAN-182]
|
||||
_ = x[VMPL-183]
|
||||
_ = x[VMSA_REGPROT-184]
|
||||
_ = x[VMX-185]
|
||||
_ = x[VPCLMULQDQ-186]
|
||||
_ = x[VTE-187]
|
||||
_ = x[WAITPKG-188]
|
||||
_ = x[WBNOINVD-189]
|
||||
_ = x[WRMSRNS-190]
|
||||
_ = x[X87-191]
|
||||
_ = x[XGETBV1-192]
|
||||
_ = x[XOP-193]
|
||||
_ = x[XSAVE-194]
|
||||
_ = x[XSAVEC-195]
|
||||
_ = x[XSAVEOPT-196]
|
||||
_ = x[XSAVES-197]
|
||||
_ = x[AESARM-198]
|
||||
_ = x[ARMCPUID-199]
|
||||
_ = x[ASIMD-200]
|
||||
_ = x[ASIMDDP-201]
|
||||
_ = x[ASIMDHP-202]
|
||||
_ = x[ASIMDRDM-203]
|
||||
_ = x[ATOMICS-204]
|
||||
_ = x[CRC32-205]
|
||||
_ = x[DCPOP-206]
|
||||
_ = x[EVTSTRM-207]
|
||||
_ = x[FCMA-208]
|
||||
_ = x[FHM-209]
|
||||
_ = x[FP-210]
|
||||
_ = x[FPHP-211]
|
||||
_ = x[GPA-212]
|
||||
_ = x[JSCVT-213]
|
||||
_ = x[LRCPC-214]
|
||||
_ = x[PMULL-215]
|
||||
_ = x[RNDR-216]
|
||||
_ = x[TLB-217]
|
||||
_ = x[TS-218]
|
||||
_ = x[SHA1-219]
|
||||
_ = x[SHA2-220]
|
||||
_ = x[SHA3-221]
|
||||
_ = x[SHA512-222]
|
||||
_ = x[SM3-223]
|
||||
_ = x[SM4-224]
|
||||
_ = x[SVE-225]
|
||||
_ = x[lastID-226]
|
||||
_ = x[APX_F-10]
|
||||
_ = x[AVX-11]
|
||||
_ = x[AVX10-12]
|
||||
_ = x[AVX10_128-13]
|
||||
_ = x[AVX10_256-14]
|
||||
_ = x[AVX10_512-15]
|
||||
_ = x[AVX2-16]
|
||||
_ = x[AVX512BF16-17]
|
||||
_ = x[AVX512BITALG-18]
|
||||
_ = x[AVX512BW-19]
|
||||
_ = x[AVX512CD-20]
|
||||
_ = x[AVX512DQ-21]
|
||||
_ = x[AVX512ER-22]
|
||||
_ = x[AVX512F-23]
|
||||
_ = x[AVX512FP16-24]
|
||||
_ = x[AVX512IFMA-25]
|
||||
_ = x[AVX512PF-26]
|
||||
_ = x[AVX512VBMI-27]
|
||||
_ = x[AVX512VBMI2-28]
|
||||
_ = x[AVX512VL-29]
|
||||
_ = x[AVX512VNNI-30]
|
||||
_ = x[AVX512VP2INTERSECT-31]
|
||||
_ = x[AVX512VPOPCNTDQ-32]
|
||||
_ = x[AVXIFMA-33]
|
||||
_ = x[AVXNECONVERT-34]
|
||||
_ = x[AVXSLOW-35]
|
||||
_ = x[AVXVNNI-36]
|
||||
_ = x[AVXVNNIINT8-37]
|
||||
_ = x[AVXVNNIINT16-38]
|
||||
_ = x[BHI_CTRL-39]
|
||||
_ = x[BMI1-40]
|
||||
_ = x[BMI2-41]
|
||||
_ = x[CETIBT-42]
|
||||
_ = x[CETSS-43]
|
||||
_ = x[CLDEMOTE-44]
|
||||
_ = x[CLMUL-45]
|
||||
_ = x[CLZERO-46]
|
||||
_ = x[CMOV-47]
|
||||
_ = x[CMPCCXADD-48]
|
||||
_ = x[CMPSB_SCADBS_SHORT-49]
|
||||
_ = x[CMPXCHG8-50]
|
||||
_ = x[CPBOOST-51]
|
||||
_ = x[CPPC-52]
|
||||
_ = x[CX16-53]
|
||||
_ = x[EFER_LMSLE_UNS-54]
|
||||
_ = x[ENQCMD-55]
|
||||
_ = x[ERMS-56]
|
||||
_ = x[F16C-57]
|
||||
_ = x[FLUSH_L1D-58]
|
||||
_ = x[FMA3-59]
|
||||
_ = x[FMA4-60]
|
||||
_ = x[FP128-61]
|
||||
_ = x[FP256-62]
|
||||
_ = x[FSRM-63]
|
||||
_ = x[FXSR-64]
|
||||
_ = x[FXSROPT-65]
|
||||
_ = x[GFNI-66]
|
||||
_ = x[HLE-67]
|
||||
_ = x[HRESET-68]
|
||||
_ = x[HTT-69]
|
||||
_ = x[HWA-70]
|
||||
_ = x[HYBRID_CPU-71]
|
||||
_ = x[HYPERVISOR-72]
|
||||
_ = x[IA32_ARCH_CAP-73]
|
||||
_ = x[IA32_CORE_CAP-74]
|
||||
_ = x[IBPB-75]
|
||||
_ = x[IBPB_BRTYPE-76]
|
||||
_ = x[IBRS-77]
|
||||
_ = x[IBRS_PREFERRED-78]
|
||||
_ = x[IBRS_PROVIDES_SMP-79]
|
||||
_ = x[IBS-80]
|
||||
_ = x[IBSBRNTRGT-81]
|
||||
_ = x[IBSFETCHSAM-82]
|
||||
_ = x[IBSFFV-83]
|
||||
_ = x[IBSOPCNT-84]
|
||||
_ = x[IBSOPCNTEXT-85]
|
||||
_ = x[IBSOPSAM-86]
|
||||
_ = x[IBSRDWROPCNT-87]
|
||||
_ = x[IBSRIPINVALIDCHK-88]
|
||||
_ = x[IBS_FETCH_CTLX-89]
|
||||
_ = x[IBS_OPDATA4-90]
|
||||
_ = x[IBS_OPFUSE-91]
|
||||
_ = x[IBS_PREVENTHOST-92]
|
||||
_ = x[IBS_ZEN4-93]
|
||||
_ = x[IDPRED_CTRL-94]
|
||||
_ = x[INT_WBINVD-95]
|
||||
_ = x[INVLPGB-96]
|
||||
_ = x[KEYLOCKER-97]
|
||||
_ = x[KEYLOCKERW-98]
|
||||
_ = x[LAHF-99]
|
||||
_ = x[LAM-100]
|
||||
_ = x[LBRVIRT-101]
|
||||
_ = x[LZCNT-102]
|
||||
_ = x[MCAOVERFLOW-103]
|
||||
_ = x[MCDT_NO-104]
|
||||
_ = x[MCOMMIT-105]
|
||||
_ = x[MD_CLEAR-106]
|
||||
_ = x[MMX-107]
|
||||
_ = x[MMXEXT-108]
|
||||
_ = x[MOVBE-109]
|
||||
_ = x[MOVDIR64B-110]
|
||||
_ = x[MOVDIRI-111]
|
||||
_ = x[MOVSB_ZL-112]
|
||||
_ = x[MOVU-113]
|
||||
_ = x[MPX-114]
|
||||
_ = x[MSRIRC-115]
|
||||
_ = x[MSRLIST-116]
|
||||
_ = x[MSR_PAGEFLUSH-117]
|
||||
_ = x[NRIPS-118]
|
||||
_ = x[NX-119]
|
||||
_ = x[OSXSAVE-120]
|
||||
_ = x[PCONFIG-121]
|
||||
_ = x[POPCNT-122]
|
||||
_ = x[PPIN-123]
|
||||
_ = x[PREFETCHI-124]
|
||||
_ = x[PSFD-125]
|
||||
_ = x[RDPRU-126]
|
||||
_ = x[RDRAND-127]
|
||||
_ = x[RDSEED-128]
|
||||
_ = x[RDTSCP-129]
|
||||
_ = x[RRSBA_CTRL-130]
|
||||
_ = x[RTM-131]
|
||||
_ = x[RTM_ALWAYS_ABORT-132]
|
||||
_ = x[SBPB-133]
|
||||
_ = x[SERIALIZE-134]
|
||||
_ = x[SEV-135]
|
||||
_ = x[SEV_64BIT-136]
|
||||
_ = x[SEV_ALTERNATIVE-137]
|
||||
_ = x[SEV_DEBUGSWAP-138]
|
||||
_ = x[SEV_ES-139]
|
||||
_ = x[SEV_RESTRICTED-140]
|
||||
_ = x[SEV_SNP-141]
|
||||
_ = x[SGX-142]
|
||||
_ = x[SGXLC-143]
|
||||
_ = x[SHA-144]
|
||||
_ = x[SME-145]
|
||||
_ = x[SME_COHERENT-146]
|
||||
_ = x[SPEC_CTRL_SSBD-147]
|
||||
_ = x[SRBDS_CTRL-148]
|
||||
_ = x[SRSO_MSR_FIX-149]
|
||||
_ = x[SRSO_NO-150]
|
||||
_ = x[SRSO_USER_KERNEL_NO-151]
|
||||
_ = x[SSE-152]
|
||||
_ = x[SSE2-153]
|
||||
_ = x[SSE3-154]
|
||||
_ = x[SSE4-155]
|
||||
_ = x[SSE42-156]
|
||||
_ = x[SSE4A-157]
|
||||
_ = x[SSSE3-158]
|
||||
_ = x[STIBP-159]
|
||||
_ = x[STIBP_ALWAYSON-160]
|
||||
_ = x[STOSB_SHORT-161]
|
||||
_ = x[SUCCOR-162]
|
||||
_ = x[SVM-163]
|
||||
_ = x[SVMDA-164]
|
||||
_ = x[SVMFBASID-165]
|
||||
_ = x[SVML-166]
|
||||
_ = x[SVMNP-167]
|
||||
_ = x[SVMPF-168]
|
||||
_ = x[SVMPFT-169]
|
||||
_ = x[SYSCALL-170]
|
||||
_ = x[SYSEE-171]
|
||||
_ = x[TBM-172]
|
||||
_ = x[TDX_GUEST-173]
|
||||
_ = x[TLB_FLUSH_NESTED-174]
|
||||
_ = x[TME-175]
|
||||
_ = x[TOPEXT-176]
|
||||
_ = x[TSCRATEMSR-177]
|
||||
_ = x[TSXLDTRK-178]
|
||||
_ = x[VAES-179]
|
||||
_ = x[VMCBCLEAN-180]
|
||||
_ = x[VMPL-181]
|
||||
_ = x[VMSA_REGPROT-182]
|
||||
_ = x[VMX-183]
|
||||
_ = x[VPCLMULQDQ-184]
|
||||
_ = x[VTE-185]
|
||||
_ = x[WAITPKG-186]
|
||||
_ = x[WBNOINVD-187]
|
||||
_ = x[WRMSRNS-188]
|
||||
_ = x[X87-189]
|
||||
_ = x[XGETBV1-190]
|
||||
_ = x[XOP-191]
|
||||
_ = x[XSAVE-192]
|
||||
_ = x[XSAVEC-193]
|
||||
_ = x[XSAVEOPT-194]
|
||||
_ = x[XSAVES-195]
|
||||
_ = x[AESARM-196]
|
||||
_ = x[ARMCPUID-197]
|
||||
_ = x[ASIMD-198]
|
||||
_ = x[ASIMDDP-199]
|
||||
_ = x[ASIMDHP-200]
|
||||
_ = x[ASIMDRDM-201]
|
||||
_ = x[ATOMICS-202]
|
||||
_ = x[CRC32-203]
|
||||
_ = x[DCPOP-204]
|
||||
_ = x[EVTSTRM-205]
|
||||
_ = x[FCMA-206]
|
||||
_ = x[FP-207]
|
||||
_ = x[FPHP-208]
|
||||
_ = x[GPA-209]
|
||||
_ = x[JSCVT-210]
|
||||
_ = x[LRCPC-211]
|
||||
_ = x[PMULL-212]
|
||||
_ = x[SHA1-213]
|
||||
_ = x[SHA2-214]
|
||||
_ = x[SHA3-215]
|
||||
_ = x[SHA512-216]
|
||||
_ = x[SM3-217]
|
||||
_ = x[SM4-218]
|
||||
_ = x[SVE-219]
|
||||
_ = x[lastID-220]
|
||||
_ = x[firstID-0]
|
||||
}
|
||||
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 90, 93, 98, 107, 116, 125, 129, 139, 151, 159, 167, 175, 183, 190, 200, 210, 218, 228, 239, 247, 257, 275, 290, 297, 309, 316, 323, 334, 346, 354, 358, 362, 368, 373, 381, 386, 392, 396, 405, 423, 431, 438, 442, 446, 460, 466, 470, 474, 483, 487, 491, 496, 501, 505, 509, 516, 520, 523, 529, 532, 535, 545, 555, 568, 581, 585, 596, 600, 614, 631, 634, 644, 655, 661, 669, 680, 688, 700, 716, 730, 741, 751, 766, 774, 785, 795, 802, 811, 821, 825, 828, 835, 840, 851, 858, 865, 873, 876, 882, 887, 896, 903, 911, 915, 918, 924, 931, 944, 949, 951, 958, 965, 971, 975, 984, 988, 993, 999, 1005, 1011, 1021, 1024, 1040, 1044, 1053, 1056, 1065, 1080, 1093, 1099, 1113, 1120, 1123, 1128, 1131, 1134, 1146, 1160, 1170, 1182, 1189, 1208, 1211, 1215, 1219, 1223, 1228, 1233, 1238, 1243, 1257, 1268, 1274, 1277, 1282, 1291, 1295, 1300, 1305, 1311, 1318, 1323, 1326, 1335, 1351, 1354, 1360, 1370, 1378, 1382, 1391, 1395, 1407, 1410, 1420, 1423, 1430, 1438, 1445, 1448, 1455, 1458, 1463, 1469, 1477, 1483, 1489, 1497, 1502, 1509, 1516, 1524, 1531, 1536, 1541, 1548, 1552, 1555, 1557, 1561, 1564, 1569, 1574, 1579, 1583, 1586, 1588, 1592, 1596, 1600, 1606, 1609, 1612, 1615, 1621}
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 73, 76, 81, 90, 99, 108, 112, 122, 134, 142, 150, 158, 166, 173, 183, 193, 201, 211, 222, 230, 240, 258, 273, 280, 292, 299, 306, 317, 329, 337, 341, 345, 351, 356, 364, 369, 375, 379, 388, 406, 414, 421, 425, 429, 443, 449, 453, 457, 466, 470, 474, 479, 484, 488, 492, 499, 503, 506, 512, 515, 518, 528, 538, 551, 564, 568, 579, 583, 597, 614, 617, 627, 638, 644, 652, 663, 671, 683, 699, 713, 724, 734, 749, 757, 768, 778, 785, 794, 804, 808, 811, 818, 823, 834, 841, 848, 856, 859, 865, 870, 879, 886, 894, 898, 901, 907, 914, 927, 932, 934, 941, 948, 954, 958, 967, 971, 976, 982, 988, 994, 1004, 1007, 1023, 1027, 1036, 1039, 1048, 1063, 1076, 1082, 1096, 1103, 1106, 1111, 1114, 1117, 1129, 1143, 1153, 1165, 1172, 1191, 1194, 1198, 1202, 1206, 1211, 1216, 1221, 1226, 1240, 1251, 1257, 1260, 1265, 1274, 1278, 1283, 1288, 1294, 1301, 1306, 1309, 1318, 1334, 1337, 1343, 1353, 1361, 1365, 1374, 1378, 1390, 1393, 1403, 1406, 1413, 1421, 1428, 1431, 1438, 1441, 1446, 1452, 1460, 1466, 1472, 1480, 1485, 1492, 1499, 1507, 1514, 1519, 1524, 1531, 1535, 1537, 1541, 1544, 1549, 1554, 1559, 1563, 1567, 1571, 1577, 1580, 1583, 1586, 1592}
|
||||
|
||||
func (i FeatureID) String() string {
|
||||
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
|
||||
|
||||
6
vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go
generated
vendored
6
vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go
generated
vendored
@@ -96,11 +96,9 @@ func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
|
||||
setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP)
|
||||
// setFeature(c, "", EVTSTRM)
|
||||
setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA)
|
||||
setFeature(c, "hw.optional.arm.FEAT_FHM", FHM)
|
||||
setFeature(c, "hw.optional.arm.FEAT_FP", FP)
|
||||
setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP)
|
||||
setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA)
|
||||
setFeature(c, "hw.optional.arm.FEAT_RNG", RNDR)
|
||||
setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT)
|
||||
setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC)
|
||||
setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL)
|
||||
@@ -108,10 +106,6 @@ func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
|
||||
setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2)
|
||||
setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3)
|
||||
setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512)
|
||||
setFeature(c, "hw.optional.arm.FEAT_TLBIOS", TLB)
|
||||
setFeature(c, "hw.optional.arm.FEAT_TLBIRANGE", TLB)
|
||||
setFeature(c, "hw.optional.arm.FEAT_FlagM", TS)
|
||||
setFeature(c, "hw.optional.arm.FEAT_FlagM2", TS)
|
||||
// setFeature(c, "", SM3)
|
||||
// setFeature(c, "", SM4)
|
||||
setFeature(c, "hw.optional.arm.FEAT_SVE", SVE)
|
||||
|
||||
78
vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go
generated
vendored
78
vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go
generated
vendored
@@ -39,80 +39,6 @@ const (
|
||||
hwcap_SHA512 = 1 << 21
|
||||
hwcap_SVE = 1 << 22
|
||||
hwcap_ASIMDFHM = 1 << 23
|
||||
hwcap_DIT = 1 << 24
|
||||
hwcap_USCAT = 1 << 25
|
||||
hwcap_ILRCPC = 1 << 26
|
||||
hwcap_FLAGM = 1 << 27
|
||||
hwcap_SSBS = 1 << 28
|
||||
hwcap_SB = 1 << 29
|
||||
hwcap_PACA = 1 << 30
|
||||
hwcap_PACG = 1 << 31
|
||||
hwcap_GCS = 1 << 32
|
||||
|
||||
hwcap2_DCPODP = 1 << 0
|
||||
hwcap2_SVE2 = 1 << 1
|
||||
hwcap2_SVEAES = 1 << 2
|
||||
hwcap2_SVEPMULL = 1 << 3
|
||||
hwcap2_SVEBITPERM = 1 << 4
|
||||
hwcap2_SVESHA3 = 1 << 5
|
||||
hwcap2_SVESM4 = 1 << 6
|
||||
hwcap2_FLAGM2 = 1 << 7
|
||||
hwcap2_FRINT = 1 << 8
|
||||
hwcap2_SVEI8MM = 1 << 9
|
||||
hwcap2_SVEF32MM = 1 << 10
|
||||
hwcap2_SVEF64MM = 1 << 11
|
||||
hwcap2_SVEBF16 = 1 << 12
|
||||
hwcap2_I8MM = 1 << 13
|
||||
hwcap2_BF16 = 1 << 14
|
||||
hwcap2_DGH = 1 << 15
|
||||
hwcap2_RNG = 1 << 16
|
||||
hwcap2_BTI = 1 << 17
|
||||
hwcap2_MTE = 1 << 18
|
||||
hwcap2_ECV = 1 << 19
|
||||
hwcap2_AFP = 1 << 20
|
||||
hwcap2_RPRES = 1 << 21
|
||||
hwcap2_MTE3 = 1 << 22
|
||||
hwcap2_SME = 1 << 23
|
||||
hwcap2_SME_I16I64 = 1 << 24
|
||||
hwcap2_SME_F64F64 = 1 << 25
|
||||
hwcap2_SME_I8I32 = 1 << 26
|
||||
hwcap2_SME_F16F32 = 1 << 27
|
||||
hwcap2_SME_B16F32 = 1 << 28
|
||||
hwcap2_SME_F32F32 = 1 << 29
|
||||
hwcap2_SME_FA64 = 1 << 30
|
||||
hwcap2_WFXT = 1 << 31
|
||||
hwcap2_EBF16 = 1 << 32
|
||||
hwcap2_SVE_EBF16 = 1 << 33
|
||||
hwcap2_CSSC = 1 << 34
|
||||
hwcap2_RPRFM = 1 << 35
|
||||
hwcap2_SVE2P1 = 1 << 36
|
||||
hwcap2_SME2 = 1 << 37
|
||||
hwcap2_SME2P1 = 1 << 38
|
||||
hwcap2_SME_I16I32 = 1 << 39
|
||||
hwcap2_SME_BI32I32 = 1 << 40
|
||||
hwcap2_SME_B16B16 = 1 << 41
|
||||
hwcap2_SME_F16F16 = 1 << 42
|
||||
hwcap2_MOPS = 1 << 43
|
||||
hwcap2_HBC = 1 << 44
|
||||
hwcap2_SVE_B16B16 = 1 << 45
|
||||
hwcap2_LRCPC3 = 1 << 46
|
||||
hwcap2_LSE128 = 1 << 47
|
||||
hwcap2_FPMR = 1 << 48
|
||||
hwcap2_LUT = 1 << 49
|
||||
hwcap2_FAMINMAX = 1 << 50
|
||||
hwcap2_F8CVT = 1 << 51
|
||||
hwcap2_F8FMA = 1 << 52
|
||||
hwcap2_F8DP4 = 1 << 53
|
||||
hwcap2_F8DP2 = 1 << 54
|
||||
hwcap2_F8E4M3 = 1 << 55
|
||||
hwcap2_F8E5M2 = 1 << 56
|
||||
hwcap2_SME_LUTV2 = 1 << 57
|
||||
hwcap2_SME_F8F16 = 1 << 58
|
||||
hwcap2_SME_F8F32 = 1 << 59
|
||||
hwcap2_SME_SF8FMA = 1 << 60
|
||||
hwcap2_SME_SF8DP4 = 1 << 61
|
||||
hwcap2_SME_SF8DP2 = 1 << 62
|
||||
hwcap2_POE = 1 << 63
|
||||
)
|
||||
|
||||
func detectOS(c *CPUInfo) bool {
|
||||
@@ -178,15 +104,11 @@ func detectOS(c *CPUInfo) bool {
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_DCPOP), DCPOP)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_EVTSTRM), EVTSTRM)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_FCMA), FCMA)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDFHM), FHM)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_FP), FP)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_FPHP), FPHP)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_JSCVT), JSCVT)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_LRCPC), LRCPC)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_PMULL), PMULL)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap2_RNG), RNDR)
|
||||
// c.featureSet.setIf(isSet(hwcap, hwcap_), TLB)
|
||||
// c.featureSet.setIf(isSet(hwcap, hwcap_), TS)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_SHA1), SHA1)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_SHA2), SHA2)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_SHA3), SHA3)
|
||||
|
||||
9
vendor/github.com/mattn/go-sqlite3/README.md
generated
vendored
9
vendor/github.com/mattn/go-sqlite3/README.md
generated
vendored
@@ -35,7 +35,7 @@ This package follows the official [Golang Release Policy](https://golang.org/doc
|
||||
- [Android](#android)
|
||||
- [ARM](#arm)
|
||||
- [Cross Compile](#cross-compile)
|
||||
- [Compiling](#compiling)
|
||||
- [Google Cloud Platform](#google-cloud-platform)
|
||||
- [Linux](#linux)
|
||||
- [Alpine](#alpine)
|
||||
- [Fedora](#fedora)
|
||||
@@ -70,6 +70,7 @@ This package can be installed with the `go get` command:
|
||||
|
||||
_go-sqlite3_ is *cgo* package.
|
||||
If you want to build your app using go-sqlite3, you need gcc.
|
||||
However, after you have built and installed _go-sqlite3_ with `go install github.com/mattn/go-sqlite3` (which requires gcc), you can build your app without relying on gcc in future.
|
||||
|
||||
***Important: because this is a `CGO` enabled package, you are required to set the environment variable `CGO_ENABLED=1` and have a `gcc` compiler present within your path.***
|
||||
|
||||
@@ -227,7 +228,11 @@ Steps:
|
||||
|
||||
Please refer to the project's [README](https://github.com/FiloSottile/homebrew-musl-cross#readme) for further information.
|
||||
|
||||
# Compiling
|
||||
# Google Cloud Platform
|
||||
|
||||
Building on GCP is not possible because Google Cloud Platform does not allow `gcc` to be executed.
|
||||
|
||||
Please work only with compiled final binaries.
|
||||
|
||||
## Linux
|
||||
|
||||
|
||||
Some files were not shown because too many files have changed in this diff Show More
Reference in New Issue
Block a user